KEGG   Ignavibacterium album: IALB_2708Help
Entry
IALB_2708         CDS       T01943                                 

Definition
(GenBank) Glycosidase
  KO
K01208  cyclomaltodextrinase / maltogenic alpha-amylase / neopullulanase [EC:3.2.1.54 3.2.1.133 3.2.1.135]
Organism
ial  Ignavibacterium album
Pathway
ial00500  Starch and sucrose metabolism
ial01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ial00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    IALB_2708
Enzymes [BR:ial01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.54  cyclomaltodextrinase
     IALB_2708
    3.2.1.133  glucan 1,4-alpha-maltohydrolase
     IALB_2708
    3.2.1.135  neopullulanase
     IALB_2708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Bac_A_amyl_C
Motif
Other DBs
NCBI-ProteinID: AFH50411
UniProt: I0AN54
Position
complement(3095842..3097635)
Genome map
AA seq 597 aa AA seqDB search
MNRIYFVLLFILNLSIYSQTSLPDWSKGIVWYQIFPERFYNGDTTNDPTADKVFVNHNSI
PNNWHITKWTSNWFERSEWEYELGGNFRDHLFERRYGGDIQGIINKLDYLNHLGIKAIYL
NPVFEAVSLHKYDASCYHHIDFNFGPNPIGDKISYQNENPENPETWQWTESDKLFLKLIE
EVHKRGMKIIIDGVFNHVGIQFWAFQDLVKNQFNSKYKDWFIVEKFDDPHTSEDEFDYKG
WWNIKSLPEFNRTTDDLADGPKKYIFNSTRRWMDPNQDGDPSDGVDGWRLDVAREVPLGF
WRQWSKLVKSINKDAILIGELWELSPDFISENGVFDALMNYNFAFAVNDFFVADKNKISV
SAFVKRLEEIDRNYPATNLFSLQNLLTSHDTERLISLVKNPDRKYDRDADERNKIYDPSK
PSSNDYEKEKMIIAFQFIYKGAPMIFYGDEIGMWGADDPHCRKPMIWSELSYDDEVIDSS
SGFSKGLGRYEVLPNFDLYNFYKKMISIRNNNLSVRVGGQKILIADDDKKLLALERFLND
ERIIAVFNLSEFIKEVPLQINFGKEVLQNLLTNKFENKFPEISGNSFVLYKIISLNK
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaatttacttcgttctcctgttcattttaaatctttcaatttattctcaaaca
tctcttccggattggtcaaaaggaatagtctggtatcagatttttccagaaagattctat
aatggtgatactaccaacgatcccacggcagataaggtttttgtaaatcataactctatt
ccgaataattggcatataacaaaatggacaagcaattggtttgaaagatccgaatgggaa
tatgaactcggcggaaattttcgcgatcatctgttcgaaagaagatacggcggagatata
caaggaataatcaataaacttgattatctgaatcacttaggaataaaggcaatctatctt
aatccggtctttgaggcagtatcattacacaaatatgatgcttcctgttatcatcatata
gactttaactttggaccaaatccaatcggagataaaatatcttatcaaaatgaaaatcct
gaaaatcctgaaacctggcaatggactgagtcagataaattatttctcaagttgattgaa
gaagttcataaaagaggaatgaaaattattattgatggcgtctttaaccatgttggaatt
cagttctgggcttttcaggatttggtaaaaaaccaattcaactcaaaatataaagattgg
tttattgttgaaaagtttgatgacccccatacatcggaagatgaattcgattataaaggt
tggtggaatataaagtctttacctgaattcaatagaaccacagatgatttagccgatggt
ccaaaaaaatatattttcaattcaaccagaagatggatggacccaaatcaagatggtgat
ccatcggatggagttgatggctggcgattggatgttgcccgtgaagtgccgcttggtttt
tggcggcagtggagtaagcttgtaaagtcaattaataaagatgcgattttaattggtgaa
ttgtgggaactatcgccagattttatttccgaaaatggtgtgtttgatgcattgatgaat
tataatttcgcttttgcagttaatgatttttttgtcgctgataaaaataaaatatcggtt
tctgcatttgtaaaacgattggaagaaatagacagaaattatcctgctacaaatttattt
tccctgcaaaatctgcttacgagtcatgatactgaaagattaatctcactagtaaagaat
cctgacagaaaatatgatcgtgatgccgatgagagaaataaaatttatgatccttccaaa
ccgtcgtcgaatgattatgaaaaagaaaagatgattatcgcatttcagtttatttacaaa
ggcgctccaatgattttttacggagatgaaattggaatgtggggtgctgatgatcctcat
tgcaggaagccaatgatttggtcggaattatcttacgatgacgaagtaattgatagctcg
tcgggtttttcaaaaggattaggcagatatgaagttcttcctaattttgacctttataat
ttttacaagaagatgatttcaataagaaataataatttgtccgtaagagttggtggacaa
aaaatcctaattgctgatgatgataaaaaacttttagcattagaaagatttttaaatgat
gagagaataatcgctgtttttaatctgagtgaatttataaaagaggtccctttacaaatt
aattttgggaaagaagtattacagaatttattaacaaataaatttgaaaataaatttcct
gaaatttcgggtaatagttttgttttatataaaattatttcactcaataagtaa

DBGET integrated database retrieval system