KEGG   Intestinimonas butyriciproducens: IB211_00237Help
Entry
IB211_00237       CDS       T04182                                 

Definition
(GenBank) Ribosomal RNA large subunit methyltransferase A
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
ibu  Intestinimonas butyriciproducens
Brite
KEGG Orthology (KO) [BR:ibu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ibu03009]
    IB211_00237
Enzymes [BR:ibu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     IB211_00237
Ribosome biogenesis [BR:ibu03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    IB211_00237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 Methyltransf_12 Ubie_methyltran
Motif
Other DBs
NCBI-ProteinID: ALP92633
UniProt: A0A0S2VZX9
Position
245763..246584
Genome map
AA seq 273 aa AA seqDB search
MSLFCCPLCAAPLEKTDRTYRCPRGHSFDRAREGYVHLLPANRMHSKAPGDDKAMAAARN
RFLSGGWYAPLRDALCRLAVDHAPARPAVLDSGCGEGYYTAGVCAALAAAGKPPETAGVD
LSKPSLRWAARREPRAEFAVASVYHLPVAPARVDLLLNCFSPLALEEFRRVLRPGGVFLY
VVPAARHLWELKQVLYERPYPNPEEDIPYEGFDYLEVLPVEETLTIRSREPLLDLFQMTP
YRWKTPRTGVERLEELEALDVTASFRIHVFRRK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgttctgctgccccctctgcgccgcgcccctggaaaagaccgacaggacctac
cggtgccccagggggcacagctttgaccgggcccgggagggctatgtccacctcctccct
gccaaccggatgcactccaaggccccgggcgacgacaaggccatggccgcggcccgaaac
cgcttcctgtccggcggctggtacgcccccctgcgcgacgcactctgccgtctggccgtg
gaccatgcgccggcgcgcccggccgtgctggactcgggctgcggggaggggtattacacc
gccggggtgtgcgcggccctggcggcggcggggaaaccgccggagacggcgggcgtggac
ctgtccaagccctccctccgctgggcggcccggcgggagccgcgggcggagttcgccgtg
gcctccgtctaccatctgccggtggcgccggcgcgggtggacctcctgctcaactgcttt
tcgcccctggccctggaggagtttcggcgggtgctgcggcccggcggggtgttcctctat
gtggtcccggcggcccggcacctctgggagctcaagcaggtcctctatgagcggccctac
cccaacccggaggaggacatcccctatgagggctttgactatctggaggtcctgcctgtg
gaggagaccctcaccatccgcagccgggagcccctgctggacctcttccagatgaccccg
taccgctggaagacgccccggaccggcgtggagcggctggaggagctggaggccctggac
gtgacggcctccttccgaatccacgtgtttcggcggaaataa

DBGET integrated database retrieval system