KEGG   Intestinimonas butyriciproducens: IB211_00451cHelp
Entry
IB211_00451c      CDS       T04182                                 

Definition
(GenBank) Glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
ibu  Intestinimonas butyriciproducens
Pathway
ibu00561  Glycerolipid metabolism
ibu00640  Propanoate metabolism
ibu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ibu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    IB211_00451c
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    IB211_00451c
Enzymes [BR:ibu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     IB211_00451c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase AIRC
Motif
Other DBs
NCBI-ProteinID: ALP92846
UniProt: A0A0S2W0F7
Position
complement(449090..450160)
Genome map
AA seq 356 aa AA seqDB search
MEAVSALKVGCGKFFHGEGVISLLAGEIMRLGGKALLVGGPTSVDRVMDAARESLDAAGV
SCVVRRHTDYCTVAWAETYAALARSEGCTVLVGVGGGKCIDEVKCAAHFAGLPIITVPTS
IATCVATSMVCIMYNEKGQRAPAVNLSKEVDVCIADTGLIASAPRRTLAAGILDSMAKMP
ECFHQKKIGSYRDCTLEEYIQVVNSRAIFEFLMGEGRDLYKNGGAARRFQDAVLTNLLHT
SIVSGFADGSGQLAVAHATYDFLRTHHTEASYHFLHGEMVAVGLLVQMAYNGSSQEEIQA
VRSLMADMHMPLTLADLEYDCSGAQRDFFLQTIAADANITTPADMSLLRAALEEAL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgtctccgcgttgaaggtcggctgcggaaaattctttcacggcgagggagtg
atctcccttctggcgggagagatcatgcgtctgggcgggaaggctcttcttgtgggcggc
cccacctcggtggaccgggtgatggatgccgcgcgggaaagcctggacgccgccggtgtc
tcctgtgtggtccgccgccacaccgattactgcaccgtcgcctgggccgagacctacgcc
gcgctggcccggtcggagggctgcacggtcctggtgggtgtggggggcggcaagtgcatc
gacgaggtgaagtgtgccgcccatttcgccggcctccccatcatcacagtgcccacctcc
atcgccacctgcgtggccacctcgatggtctgcattatgtataatgagaagggccaacgg
gccccggccgtcaacctgagcaaggaggtggatgtgtgcatcgccgacaccggcctcatc
gcctccgccccccgccgcacgctggccgccgggattctggactccatggccaagatgccc
gaatgcttccatcaaaagaagatcgggagctatcgggactgcacgctggaggagtacatc
caggtcgtcaacagccgggccatttttgaatttctgatgggcgagggccgggacctctac
aaaaacggcggcgcggcccggcgcttccaggacgcagtgctcaccaatctgctccacacc
tccatcgtcagcgggtttgccgacggctccgggcagttggccgtggcccatgccacctat
gacttcctgcgcacccatcataccgaggccagctatcattttctccacggcgagatggtg
gcggtgggtctgctggtccagatggcttataacggctcctctcaggaggagatccaggcc
gtccggagcctgatggccgacatgcacatgcccctgaccctggcggacctggagtacgac
tgctccggcgctcagcgggactttttcctccagaccattgccgcggacgccaacatcacc
acgcctgcggacatgtccctcctgcgtgccgctctggaggaggcgctctga

DBGET integrated database retrieval system