KEGG   Intestinimonas butyriciproducens: IB211_00601cHelp
Entry
IB211_00601c      CDS       T04182                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ibu  Intestinimonas butyriciproducens
Pathway
ibu00071  Fatty acid degradation
ibu00072  Synthesis and degradation of ketone bodies
ibu00280  Valine, leucine and isoleucine degradation
ibu00310  Lysine degradation
ibu00362  Benzoate degradation
ibu00380  Tryptophan metabolism
ibu00620  Pyruvate metabolism
ibu00630  Glyoxylate and dicarboxylate metabolism
ibu00640  Propanoate metabolism
ibu00650  Butanoate metabolism
ibu00900  Terpenoid backbone biosynthesis
ibu01100  Metabolic pathways
ibu01110  Biosynthesis of secondary metabolites
ibu01120  Microbial metabolism in diverse environments
ibu01130  Biosynthesis of antibiotics
ibu01200  Carbon metabolism
ibu01212  Fatty acid metabolism
ibu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ibu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    IB211_00601c
   00630 Glyoxylate and dicarboxylate metabolism
    IB211_00601c
   00640 Propanoate metabolism
    IB211_00601c
   00650 Butanoate metabolism
    IB211_00601c
  09103 Lipid metabolism
   00071 Fatty acid degradation
    IB211_00601c
   00072 Synthesis and degradation of ketone bodies
    IB211_00601c
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IB211_00601c
   00310 Lysine degradation
    IB211_00601c
   00380 Tryptophan metabolism
    IB211_00601c
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IB211_00601c
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IB211_00601c
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    IB211_00601c
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ibu04147]
    IB211_00601c
Enzymes [BR:ibu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     IB211_00601c
Exosome [BR:ibu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IB211_00601c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: ALP92996
UniProt: A0A0S2W0Z9
Position
complement(580845..582131)
Genome map
AA seq 428 aa AA seqDB search
MPLADRQQRSTEQVEQCGINIIYMEGRKTMKEVVIVSAVRTPIGSIGGTLKNTLPEKLLA
TAYEGAIEKAGISKDMFDEVIAGQAKQTTDAPNIARVSSLMLQIPEATPAYTVHRQCASG
MQAMLSSMQQIQCDYSDIMLCGGVESMSTAPFYVRNVRFGVGNGNQALVDPNTESQPKSQ
PADIYGTFTMIQTADNVAKQFGVTREDCDQFALESQHRAVAAIDSGRFKDEIVPVVIPQR
KKDPIVFDTDEYPKRDTNLEKMAKLKPIFADGVTTAGNASGRNDGASALVLMSADKAKEL
GLKPIARIIAGAAAGVDPRIMGMGPVAATRKLMKALEPKGLKLEDFGLVEINEAFAAQSV
ACVRELGLNPEIVNVNGGAIALGHPLGCSGARISTTLVHEMQKRDVQFGLASICIAGGLG
MAMAFEKL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgccgcttgctgacagacaacagcgcagcacggaacaggtcgaacagtgcggtatcaat
attatttatatggagggacgcaaaaccatgaaagaagtagtcatcgtatccgcagtccgt
actcccatcggctccatcggcggcacgctgaagaacaccctgccggagaagttgctggcc
actgcctatgagggcgccatcgagaaggccggcatcagcaaggacatgttcgatgaggtc
attgccggtcaggccaagcagaccaccgacgcccccaacatcgcccgtgtctcctccctg
atgctccagatccccgaggccacccccgcctacaccgtccatcgtcagtgcgcctccggc
atgcaggccatgctctccagcatgcagcagatccagtgcgattactccgacatcatgctc
tgcggcggcgtcgagagcatgagcaccgcccccttctatgtccgcaacgtgcgcttcggc
gtgggcaacggcaatcaggccctggtggaccccaacaccgaaagccagcccaagagccag
cccgccgatatctacggcaccttcaccatgatccagaccgccgacaacgtcgccaagcag
ttcggcgtcactcgtgaggactgcgatcagttcgctctggagagccagcaccgcgccgtg
gccgccattgactccggccgtttcaaggatgagatcgtccccgtggtgatcccccagcgc
aagaaagaccccatcgtgttcgacaccgacgagtatcccaagcgggacaccaatctggag
aagatggcgaagctcaaacccatcttcgccgacggcgtgaccactgccggcaacgcttcc
ggccgcaacgacggcgcctccgccctggtgctgatgtccgccgacaaggccaaggagctg
ggcctcaagcccatcgcccgcatcatcgccggcgcagccgccggtgtggacccccgcatc
atgggcatgggccccgtggccgcgacccgcaagctgatgaaggctctggagcccaagggg
ctgaaactggaggacttcggcctggtggagatcaacgaggcctttgccgcccagtctgtg
gcctgcgtccgcgagctgggcctcaaccccgagatcgtcaacgtcaacggcggcgccatc
gccttgggccatcccctcggctgctccggcgcccgcatttccaccaccctggtccacgag
atgcagaagcgggacgtccagttcggcctcgcctccatctgcatcgccggcggcctgggc
atggccatggccttcgagaaactctaa

DBGET integrated database retrieval system