KEGG   Intestinimonas butyriciproducens: IB211_01691cHelp
Entry
IB211_01691c      CDS       T04182                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate synthase
  KO
K01662  1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
ibu  Intestinimonas butyriciproducens
Pathway
ibu00730  Thiamine metabolism
ibu00900  Terpenoid backbone biosynthesis
ibu01100  Metabolic pathways
ibu01110  Biosynthesis of secondary metabolites
ibu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ibu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    IB211_01691c
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IB211_01691c
Enzymes [BR:ibu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     IB211_01691c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_synthase_N Transket_pyr Transketolase_C Transketolase_N TPP_enzyme_C E1_dh
Motif
Other DBs
NCBI-ProteinID: ALP94082
UniProt: A0A0S2W4C1
Position
complement(1672811..1674658)
Genome map
AA seq 615 aa AA seqDB search
MIQLDEIPNLKEISDSEAEGLCARLRARIIDAVSRTGGHLASNLGTVEITVALHRVFDTG
RDRVVFDVGHQCYSHKILTGRDTAMDTLRTFGGIAGYPKPQESQDDAFIAGHASNSVSVA
LGMARARSQRGEDYHVIALIGDGALTGGLAYEGLSNAGLSGEPLLVILNDNGMSITKNVG
GVAQHLAHQRLKPQYLQFKKGYRKMMSVLPGGPQIYRVTHKIKTAIKETLLPCSMFEDMG
FIYLGPVDGHDVRGLTRLMRYAKELKGPVLLHVRTVKGKGYPPAEKNPDAYHGVSRFCVQ
TGEPLQPSRPSFSSAFGQAVCELAAEDGRICAVTAAMRDGTGLGSFEAQFPERFFDVGIA
EGHAVAMAAGMAKQGSLPIFAVYSSFLQRGYDMLLHDVAILGLHVVFGVDRAGLVGEDGE
THHGLFDVAYLSSVPGMTLFAPASFAEVRSMLRHAVRKVSGPVALRYPRGGESGYRGDAG
VEPTVCLKVGKAITLVTYGITTGSVLEAGAMLEAAGYAPEIIKLNRLMPLDDEEILASVK
KTERVLIAEECAAMGGMGQQIAAHMAAQGVVPKAMALCNTGSGFITHGTTAELRRLCGLD
AESLYQAAVEVLKRE
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
ttgatacagctcgatgagattccaaatctaaaagagattagcgacagcgaggcggagggc
ctctgtgcgcggctgcgggcccgcattatcgacgcggtctcacgcacgggaggacatttg
gcctccaatctcggtacggtggagatcaccgtagcgctccaccgggtatttgataccggg
cgggacagagtggtttttgacgtgggacaccaatgctattcccacaagatcctgacgggg
cgggacacggccatggacaccctccgcacgtttggagggattgcgggctaccccaagcca
caggaaagccaggatgacgcctttattgcgggacatgcctccaactctgtttctgtggcg
ctgggaatggccagagccaggagccagagaggggaggactaccacgtgatcgccctcatt
ggagacggggccctgacaggcggacttgcctatgaagggctttccaacgcagggttgagc
ggagagccccttctggtcatcctaaatgacaatggcatgtccattaccaaaaatgtgggg
ggcgtggcccaacacctagcacatcagcggctcaagccacagtatcttcagttcaaaaag
ggataccgaaaaatgatgtcggtgctgccaggcggtccccaaatctaccgtgtgacccat
aaaatcaaaacggcgataaaggagactctgctcccctgcagtatgttcgaggatatgggg
ttcatttacctggggccggtggacgggcatgatgtgagagggctcactcgcctgatgcgc
tacgccaaggagttgaaaggccctgtattgcttcatgtaaggactgtaaaggggaaaggc
tatccgccagctgaaaagaatccggatgcctaccatggcgtatcacggttttgtgtccag
acaggtgagccgctgcagccctccaggccctccttttccagcgcgtttggacaggctgtc
tgcgagctggcggcggaggatgggagaatctgtgcggtgactgctgccatgcgggacggc
accggactgggctcctttgaggctcaattcccggaacgatttttcgatgtggggattgcg
gaggggcacgccgtggcgatggcggctggaatggccaagcagggaagtctgccgatcttt
gccgtgtactcctcgtttctgcagcgcgggtatgatatgctgctccacgatgtggcgatc
cttggcctccatgtggtcttcggcgtagaccgtgctggattggtgggagaagacggcgag
acccaccacggtctgtttgatgtggcgtatctctcctcggtcccggggatgacgctcttc
gcgccggccagctttgctgaagtgcggagcatgctgcgccacgccgtgcggaaggtatcg
gggccagtggctctccgctatccaagaggcggagagagcggctatcggggagatgcaggt
gtggagccgactgtgtgtctgaaagtggggaaagcaataacacttgtcacttatgggatc
actacggggagtgtactggaggccggcgctatgttggaggcggctggatacgccccggaa
atcataaagctgaatcgccttatgccgttggatgacgaagaaatccttgcttccgtaaag
aaaacggagcgggtcctgattgccgaggagtgcgccgcaatgggaggtatggggcagcaa
atcgctgcccacatggcggcacagggggtcgtgcccaaagcgatggcgctctgcaatacg
ggaagtgggtttatcacccatggaaccacggcggagctgcgccgcctgtgcgggctggat
gcggaatcgctttaccaggcggcagtggaggttttaaagcgtgagtaa

DBGET integrated database retrieval system