KEGG   Intestinimonas butyriciproducens: IB211_03341c
Entry
IB211_03341c      CDS       T04182                                 

Definition
(GenBank) Xanthine dehydrogenase iron-sulfur subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ibu  Intestinimonas butyriciproducens
Pathway
ibu00230  Purine metabolism
ibu01100  Metabolic pathways
ibu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ibu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    IB211_03341c
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: ALP95729
UniProt: A0A0S2W8M6
Position
complement(3330606..3331100)
AA seq 164 aa
MMEILHCTVNGRPVEVGYDLRESLLDTLRDRLGLTSVKRGCEVGECGACTVLVDGVAIDS
CIYLTCWAEGKHILTVEGLQGENGELTEIQKAFIEEAAVQCGFCTPGIILSAVEIVGTGR
TYTREELRKLISGHLCRCTGYQNILNAVEKAVNVCNGYVGEKQS
NT seq 495 nt   +upstreamnt  +downstreamnt
atgatggaaattctgcactgcaccgtcaacggaaggccggtggaggtggggtacgacctg
cgggagtccctgctggacaccctgcgggaccggttgggccttaccagcgtcaagcggggc
tgcgaggtaggggagtgcggggcttgtactgttctggtggacggcgtggccatcgactcc
tgcatctatctcacctgttgggcggagggaaaacacatcctgactgtggaaggactccag
ggggaaaatggggagctcaccgagatccagaaggcgtttatcgaggaggccgccgtccag
tgcggcttctgcaccccgggcatcattctctccgctgtggagattgtgggaacagggcga
acgtacacacgggaggagctccgaaagctgatctccggccatctgtgccgctgcaccggc
tatcagaacatcctcaacgccgtggagaaggcggtcaacgtctgcaacggctacgtgggg
gagaaacagagttaa

DBGET integrated database retrieval system