KEGG   Intrasporangium calvum: Intca_0907Help
Entry
Intca_0907        CDS       T01385                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ica  Intrasporangium calvum
Pathway
ica00450  Selenocompound metabolism
ica00970  Aminoacyl-tRNA biosynthesis
ica01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ica00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Intca_0907
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Intca_0907
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ica01007]
    Intca_0907
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ica03016]
    Intca_0907
Enzymes [BR:ica01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Intca_0907
Amino acid related enzymes [BR:ica01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Intca_0907
Transfer RNA biogenesis [BR:ica03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Intca_0907
 Prokaryotic type
   Other AARSs
    Intca_0907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ADU47434
UniProt: E6SC90
Position
992841..994664
Genome map
AA seq 607 aa AA seqDB search
MSKVLSAVAWPYTNGPRHIGHVAGFGVPSDVFSRYMRMAGHDVLMVSGTDEHGTPILVLA
EKEGMTPQEVTDKYNRVIATDLTELGLSYDLFTRTTTANHYAVSQELFSGNWRNGYMIEQ
TTKGAISPSTGRTLPDRYIEGTCPICGYGEARGDQCDNCGNQLDAEELINPRSKINGETP
EFIETQHFFLDLPALATALAEWLDGREGSGTWRPNVIKFARNLLDDVRPRAMTRDIDWGI
PIPLEGWQDNTHKRLYVWFDAVVGYLSASIEWARRVGDPERWREWWNDPEAVSYYFQGKD
NITFHAQIWPAELLGYAGLGEKGGSAGAYGTLNLPTEVVASEFMTMEGKQFSTSRGHVIY
VRDVLERYGPDPLRYFICAAGPENQDSDFTWAEFIQRNNSELVAGWGNLVNRTASMIAKS
FGEIPAAGPLEPVDEALLTAVREAFDVVGGLIERQRFKQGIGEVMRVVGEANRYVAETEP
FKLKGDDERERLGTVLHVLAQAVVSINTLMAPFLPHGSNRVHRVMGGEGDFVPMPVLEEV
TDLDDGRPYPVITGEYSATPRWEHVPVVVGTPIPKPTPVFTKFDPSVVEEEIERMRGEDA
GEAGAAR
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagtcctgtctgctgtcgcctggccgtacaccaacggcccgcggcacatcggc
cacgtggccgggttcggtgtgccctccgacgtcttcagtcggtacatgcggatggccgga
cacgacgtgctcatggtctccgggacggacgagcacggcacgccgatcctcgtcctcgcc
gagaaggaggggatgacgccgcaggaggtcacggacaagtacaaccgcgtcatcgcgacc
gacctgaccgagctcggcctctcctacgacctcttcacgcggacgaccacggccaaccac
tacgccgtgtcccaggagctcttcagcggcaactggcgcaacggctacatgatcgagcag
acgaccaagggtgccatcagcccgtcgaccgggcggaccctgcccgaccgctacatcgag
ggcacctgcccgatctgcggctacggcgaggcccgcggcgaccagtgcgacaactgcggc
aaccagctcgacgccgaggagctgatcaacccgcggagcaagatcaacggcgagacgccc
gagttcatcgagacgcagcacttcttcctcgacctccccgcgctcgcaacggccctggcg
gaatggctcgacgggcgggaggggtcgggcacgtggcggcccaacgtcatcaagttcgcc
cgcaacctcctcgacgacgtgcggccgcgcgcgatgacccgcgacatcgactggggcatc
cccatcccgctcgaggggtggcaggacaacacgcacaagcggctctacgtctggttcgac
gcggtcgtcggctacctgtcggcgtcgatcgagtgggcgcgtcgcgtcggcgaccccgag
cggtggcgcgagtggtggaacgacccggaggccgtgtcgtactacttccagggcaaggac
aacatcaccttccacgcgcagatctggcccgccgagctgctcggctacgcggggctcgga
gagaagggcggatccgcgggggcctacgggacgctcaacctgcccaccgaggtcgtcgcg
tccgagttcatgacgatggagggcaagcagttctccacctcacggggccacgtcatctac
gtccgcgacgtgctggagcggtacggcccggacccgctgcgctacttcatctgcgcggcc
ggcccggagaaccaggacagcgacttcacctgggcagagttcatccagcgcaacaacagc
gagctcgtcgccggctggggcaacctcgtcaaccggaccgcgtcgatgatcgcgaagagc
ttcggcgagatccctgcggcggggccgctcgagccggtcgacgaggcgctgctcaccgcc
gtgcgcgaggcgttcgacgtggtcggcggcctcatcgagcggcagcggttcaagcagggc
atcggcgaggtcatgcgggtcgtcggagaggcgaaccgctacgtggccgagacggagccg
ttcaagctcaagggcgacgacgagcgcgagcggctggggacggtcctgcacgtgctggcc
caggccgtggtctccatcaacaccctgatggctcccttcctgccgcacggctccaaccgg
gtccaccgggtcatgggcggggagggtgacttcgtcccgatgccggtcctcgaggaggtc
accgacctcgacgacggacgcccctaccccgtgatcaccggcgagtactccgccacgccg
cgctgggagcacgtcccggtcgtcgtcgggacgccgatccccaagccgactcccgtgttc
accaagttcgacccgtccgtcgtcgaggaggagatcgagcggatgcgcggtgaggacgcg
ggcgaggcgggcgccgcccgatga

DBGET integrated database retrieval system