KEGG   Intrasporangium calvum: Intca_0951Help
Entry
Intca_0951        CDS       T01385                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ica  Intrasporangium calvum
Pathway
ica00010  Glycolysis / Gluconeogenesis
ica00052  Galactose metabolism
ica00500  Starch and sucrose metabolism
ica00520  Amino sugar and nucleotide sugar metabolism
ica00521  Streptomycin biosynthesis
ica01100  Metabolic pathways
ica01110  Biosynthesis of secondary metabolites
ica01120  Microbial metabolism in diverse environments
ica01130  Biosynthesis of antibiotics
ica01200  Carbon metabolism
Module
ica_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Intca_0951
   00052 Galactose metabolism
    Intca_0951
   00500 Starch and sucrose metabolism
    Intca_0951
   00520 Amino sugar and nucleotide sugar metabolism
    Intca_0951
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Intca_0951
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Intca_0951
Enzymes [BR:ica01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Intca_0951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ADU47476
UniProt: E6SCS1
Position
1050493..1051422
Genome map
AA seq 309 aa AA seqDB search
MAQTVVALDIGGTKTAAALVTAEGAVTDVTTAPTPGDQGPEAIVRVASGLAADLLVTATA
RGHEVVGLGVGSAGVIDTATGRVVSATEVLRDWAGTEVRDALSELSGIRHVVVDNDVHAH
ALGETWLGAASGASSAFFVAVGTGIGASVVIDGTVWHGRRDVAGHFGHVAVPHAGGMPCV
CGGSGHLEAVAAGPAMVWSYNRRARADLTSLADVARRADAGDRLAVMTIDIGARALGSAI
GGAANLLDPEVVVIGGGVPGIGARWWEPMEEAVRAELLPPLAELPVLPARLGSAAALVGA
ARLVWKGLA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggctcagaccgtcgtcgccctcgacatcggcggcaccaagactgccgccgcactcgtc
accgcggagggtgccgtcaccgacgtgacgacggcgcccacaccgggtgaccaggggccg
gaggccatcgtccgggtcgcctccggcctcgcagccgacctcctcgtgaccgcgaccgcc
cgcggtcacgaggtggtcggtctcggtgtcggcagcgccggggtcatcgacaccgcgacc
ggccgcgtcgtctccgccacggaggtcctgcgcgactgggcgggcacggaggtcagggac
gcactgagcgagctcagcggcatccggcacgtcgtggtcgacaacgacgtccacgcccac
gccctgggcgagacctggctcggcgccgcgtccggtgcctcgagcgccttcttcgtcgcg
gtcggcaccggcatcggtgcgtccgtcgtcatcgacgggaccgtgtggcacggccgccgc
gacgtcgccgggcacttcggacacgtcgcagtgccccacgccggcggaatgccctgtgtc
tgcgggggatctggccacctcgaggccgtcgcggctgggccggccatggtctggtcgtac
aaccggcgggcccgcgccgacctcacgtcgctcgccgacgtcgcccgccgcgccgacgcc
ggcgaccgcctcgccgtgatgaccatcgacatcggcgcgcgggcgctcggcagcgccatc
ggcggggccgccaacctgctcgacccggaggtcgtggtcatcggcggaggcgtccccggc
atcggcgcccgctggtgggagccgatggaggaagccgtgcgggccgagctgctgcccccg
ctcgcggagctgccggtgctcccggcccggctcggctcggctgccgccctcgtcggcgcc
gcccggctcgtctggaagggactcgcgtga

DBGET integrated database retrieval system