KEGG   Intrasporangium calvum: Intca_1095Help
Entry
Intca_1095        CDS       T01385                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ica  Intrasporangium calvum
Pathway
ica00360  Phenylalanine metabolism
ica00362  Benzoate degradation
ica00620  Pyruvate metabolism
ica00621  Dioxin degradation
ica00622  Xylene degradation
ica00650  Butanoate metabolism
ica01100  Metabolic pathways
ica01120  Microbial metabolism in diverse environments
ica01220  Degradation of aromatic compounds
Module
ica_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Intca_1095
   00650 Butanoate metabolism
    Intca_1095
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Intca_1095
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Intca_1095
   00622 Xylene degradation
    Intca_1095
   00621 Dioxin degradation
    Intca_1095
Enzymes [BR:ica01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Intca_1095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh NAD_binding_3 GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ADU47616
UniProt: E6SE03
Position
complement(1211808..1212815)
Genome map
AA seq 335 aa AA seqDB search
MANHTPRTKGTAAIVGPGNIGTDLMFKLMRRSDVIEPRWMIGVDPSSDGLRRAKSLGLEA
SHEGVDWLLAQDELPDIVFECTSAKAHEANAPRYAEAGILAVDLTPAAVGPYLCPPVNLE
FNLDAMNVNMITCGGQATTPIVAAISSVVPVPYAEIVASISSKSAGPGTRANIDEFTETT
AAALEVVGGAQRGKAIIILNPVEPPLMMRNTVFCAIPDEAAEPGALQDAILESIHRMVAT
VQEYVPGYHLRADVQFDPSRETWKGQARVFVPIEVKGRGDYLPDYAGNLDIITAAAARVG
DILVAHRLGVASTWKSSADLGELPDAASPAEKAGV
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaccacaccccacggaccaagggcactgctgccatcgtcggccccggcaacatc
ggcaccgacctcatgttcaagctgatgcgccgcagcgacgtcatcgagccgcgctggatg
atcggcgtcgacccctcctcggacggcttgcgtcgggcgaagtcgctcggtctcgaggcc
tcccacgagggcgtcgactggctcctcgcccaggacgagctgcccgacatcgtcttcgag
tgcacgtcggccaaggcccacgaggcgaacgcgccccgctacgccgaggccggcatcctc
gccgtcgacctgacccccgctgccgtgggcccctacctctgcccgccggtcaacctcgag
ttcaacctcgacgcgatgaacgtcaacatgatcacctgcggcggtcaggcgaccaccccg
atcgtcgcggcgatctcgagcgtcgtccccgtgccgtacgcggagatcgtcgcctcgatc
tcctccaagtcggccggtcccggcacccgggccaacatcgacgagttcaccgagacgacc
gccgccgccctcgaggtcgtcggtggcgcccagcgcggcaaggcgatcatcatcctcaac
cccgtcgaaccgccgctgatgatgcgcaacaccgtcttctgcgccatccctgacgaggcg
gccgagcccggcgccctccaggacgcgatcctcgagtcgatccaccgcatggtggcgacc
gtccaggagtacgtccccggctaccacctgcgcgccgacgtccagttcgacccctcacgc
gagacgtggaagggccaggcccgggtcttcgtcccgatcgaggtcaagggccgtggcgac
tacctgccggactacgccggcaacctcgacatcatcaccgcggctgccgcccgcgtcggc
gacatcctcgtcgcccaccgcctcggcgtcgcgtccacgtggaagtcctcggcggacctc
ggggagctcccggacgccgcaagccccgcagagaaggcaggagtctga

DBGET integrated database retrieval system