KEGG   Intrasporangium calvum: Intca_1216Help
Entry
Intca_1216        CDS       T01385                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
ica  Intrasporangium calvum
Pathway
ica00240  Pyrimidine metabolism
ica01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Intca_1216
Enzymes [BR:ica01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Intca_1216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N TMP_2
Motif
Other DBs
NCBI-ProteinID: ADU47734
UniProt: E6SFI9
Position
1357271..1358569
Genome map
AA seq 432 aa AA seqDB search
MTGTTEGFDAVDIIAAKRDGLRLGGEQIDWVVDAYTRGVVAEEQMAALAMAIYLNGMTAE
EIARWTDAMIRSGERLDFSGLSRPTSDKHSTGGVGDKITLPLAPLVAACGVAVPQLSGRG
LGHTGGTLDKLESIPGWRASLTNEEMLRQLEDVGAVICAAGSGLAPADKKLYALRDVTAT
VSCIPLIASSIMSKKIAEGTGSLVLDVKVGSGAFMKELDDARELARTMVRLGTDAGVRTV
ALLTNMSTPLGLTAGNALEVRESVEVLEGGGPQDVVELTVALAREMVAAAGKDDIDPSDA
LADGRAMDVWRRMIRAQGGDPDAPLPTAKETHEVPAPADGVLVRLDALAVGVAAWRLGAG
RGRREDPVQAGAGVEIHYKPGAVVRGGEPLLTLHTDTPERFERAIEALKGAYVIAPEGSR
PDLPPIVIDRIS
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtgactgggacgactgagggtttcgacgccgttgacatcatcgccgccaaacgcgacggc
ctccggttgggcggggagcagatcgactgggtggtcgacgcctacacccgaggtgtcgtg
gccgaggagcagatggcagccctggccatggccatctacctcaacggcatgacagcggag
gagatcgcccgctggaccgatgcgatgatcaggtccggtgagcggctggacttctccggg
ctctcgcgaccgacgagcgacaagcactccaccggcggggtcggcgacaagatcaccctg
ccgctcgcccccctcgtcgcagcctgcggcgtagcggtcccgcagttgtcgggccgcggc
ctcggccacaccggaggcaccctcgacaagctcgagtcgatccccggctggcgcgcctcg
ctgaccaacgaggagatgctgcgtcagctcgaggacgtgggcgcggtgatctgcgctgca
ggctcgggcctggccccggccgacaagaagctctacgcgttgcgcgacgtgacggccacg
gtctcctgcataccgctgatcgcctcgtccatcatgagcaagaagatcgctgaggggacg
gggtccctggtcctcgacgtcaaggtcggctccggtgcgttcatgaaggagctcgacgac
gcccgggagctggcccggaccatggtgcgcctgggcaccgacgccggcgtcaggacggtg
gccctgctgacgaacatgtcgacgcccctcggactcaccgccggcaacgcgctcgaggtg
cgcgagtcggtcgaggttctcgaaggcggcgggccacaggacgtcgtcgagctcacggtg
gcgctcgcccgagagatggttgccgctgcgggcaaggacgacatcgacccgtccgacgcc
ctcgccgacggacgcgccatggacgtgtggcgtcggatgatccgggcgcagggcggcgac
ccggacgcacccctgcccacggcgaaggagacgcacgaggtccccgctcccgcggacggt
gtgctcgtccggctcgacgcgctggccgtgggggtggccgcctggcgcctcggcgccggg
cggggtcgcagggaggacccggtccaggcgggggcgggcgtcgagatccactacaagccc
ggggcagtggtgcggggtggcgagccgctgctcacgctgcacaccgacacgccagagcgc
ttcgagcgggcgatcgaggctctcaagggggcctacgtgatcgcgcctgaggggtcccga
ccggacctgccgccgatcgtgatcgaccgcatctcctag

DBGET integrated database retrieval system