KEGG   Intrasporangium calvum: Intca_1397Help
Entry
Intca_1397        CDS       T01385                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ica  Intrasporangium calvum
Pathway
ica00330  Arginine and proline metabolism
ica00332  Carbapenem biosynthesis
ica01100  Metabolic pathways
ica01130  Biosynthesis of antibiotics
ica01230  Biosynthesis of amino acids
Module
ica_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Intca_1397
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Intca_1397
Enzymes [BR:ica01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Intca_1397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ADU47913
UniProt: E6S718
Position
complement(1560261..1561373)
Genome map
AA seq 370 aa AA seqDB search
MSPRSVISSARRLVVKVGSSSLTGVDGGIDHARLIALVNALAHQHLRGAQIVLVSSGAIA
AGLHPLGLTARPRDLATQQAAASVGQGALLAAYTQSFAAHEITVGQVLLTAEDVTRRTHY
ANARRTLERLLDLRVLPIVNENDTVATSEIRFGDNDRLAALVAHLIDADALVLLSDVDAL
YDGPPSRPGAQRIPIVAGPEDIAHVAIGGSGSKVGTGGMATKIEAARIATAAGVTTSITA
ADRIIEVLRGEDVGTLFLPIGRRGRSRRLWLEHATSARGRLIVDEGAVHALKERKKSLLP
AGITAVEGTFHDGDPVDVCGPDGTPIARGLVNYASNELPNLLGRSTRELAKALGPAYERE
VIHRDDLVVL
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gtgtcacctcgctccgtcatcagcagcgcccgccgcctcgtcgtcaaggtgggctccagc
tcgctgaccggggtcgacggtggcatcgaccacgctcggctcatcgccctcgtcaacgcg
ctggcccaccagcaccttcggggagcgcagatcgtcctcgtcagctcgggggccatcgcg
gccgggctgcacccgctcggcctgaccgcacgcccccgggacctcgcgacccagcaggcc
gcagcgagcgtgggtcagggcgccctgctcgccgcgtacacgcagtccttcgccgcccac
gagatcaccgtcggacaggtcctcctcacggccgaggacgtgacccggcggacccactac
gccaacgcccggcgcaccctcgagcggctgctcgacctgcgcgtgctgcccatcgtcaac
gagaacgacaccgtcgcgacgtcggagatccggttcggcgacaacgaccgcctcgccgct
ctcgtggcgcacctcatcgacgccgacgccctcgtcctcctctcggacgtcgacgcgctc
tacgacgggccaccgagccggcccggggcacagcgcatcccgatcgtcgccggccccgag
gacatcgcccacgtcgcgatcgggggcagcggctccaaggtcggcacgggcggcatggcg
accaagatcgaggcggcccggatcgcgacggccgccggggtcacgacgtcgatcaccgcc
gcggaccgcatcatcgaggtcctccggggcgaggacgtcggcaccctcttcctccccatc
ggtcggcggggccggtcccggcggctctggctcgagcacgcgacctcggcgcgtgggcgg
ctcatcgtcgacgagggcgcggtgcacgctctcaaggaacgcaagaagtcgctgctcccc
gcggggatcacggccgtcgagggcaccttccacgacggcgacccggtggacgtgtgcggg
cccgacggcacgccgatcgcgcgcggcctcgtcaactatgcgtcgaacgagctgccgaac
ctcctcggccgttcgacgagggagctggccaaggcgctcgggccggcctacgagcgcgag
gtcatccaccgggacgacctcgtcgtgctctga

DBGET integrated database retrieval system