KEGG   Intrasporangium calvum: Intca_1517Help
Entry
Intca_1517        CDS       T01385                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
ica  Intrasporangium calvum
Pathway
ica00471  D-Glutamine and D-glutamate metabolism
ica00550  Peptidoglycan biosynthesis
ica01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ica00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Intca_1517
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Intca_1517
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ica01011]
    Intca_1517
Enzymes [BR:ica01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Intca_1517
Peptidoglycan biosynthesis and degradation proteins [BR:ica01011]
 Precursor biosynthesis
  Amino acid ligase
   Intca_1517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M FAD_binding_3 NAD_binding_7 Pyr_redox_3 AlaDh_PNT_C Pyr_redox_2 Pyr_redox GIDA
Motif
Other DBs
NCBI-ProteinID: ADU48031
UniProt: E6S8B0
Position
1706274..1707764
Genome map
AA seq 496 aa AA seqDB search
MTFDPAYEPRPGLTHRDADWSGLRVLVVGLGISGFAAADALAERGATVTAVSRDVTDVIT
ERATILDILGVDVRLGAEHVHEPPDDVELIITSPGVPPHDPLMLAAATRGLPVWGEVELA
WRMRPLEGAAPWLTVTGTNGKTTTVNMLASILRASGLRATSAGNVGTPILEAVLHPEPYD
VLAVELSSFQLHWQRSISAVASAVLNVAPDHLDWHGSYAEYLRAKGKIYDNTHLACVYNV
ADIQTEQLVMEAEVVEGCRAVGFTTGIPAPSMIGVVDDVLADRAFVEQRQRSAAELCTLD
DLRGDAPSVAPHYLANALAAAALARAYGVGPLAVRDGLRAFRPDRHRIAEVATVRGVRWV
NDSKATNTHAAAAALTSFDSVVWIAGGLLKGADVDSLVEEVASRLRGVVLIGADRARIAE
ALARHAPDVPVIDLPDTDTGVMDLVVTHAARLAHPGDVVLLAPAAASMDMFTNYGARGDA
FEDAVRRHLEASGGDL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcgatcctgcctacgagccacgtccggggctgacgcaccgggacgcggactgg
tccgggctccgggtgctcgtcgtcggcctcggcatctcggggttcgcggcggccgacgcg
ctcgccgaacgtggcgccacggtcaccgccgtgtcgagggacgtcaccgacgtgatcacc
gagcgggccacgatcctcgacatcctgggcgtcgacgtccgactcggcgcggagcacgtc
cacgagccgcccgacgacgtcgagctgatcatcacctcgcccggggtgccgccccatgac
ccgctcatgctggccgccgcgacccgaggtctgcccgtctggggtgaagtcgagctcgcc
tggcggatgcggccgctcgagggcgcggccccctggctgaccgtgaccggtaccaacggc
aagacgacgaccgtcaacatgctcgcgtcgatcctgcgcgcctccggcctgcgtgccacc
tctgccggcaatgtcggcaccccgattctcgaggccgtcctgcaccccgagccctacgac
gtgctggccgtcgagctctccagcttccagctgcactggcagcgctcgatctcggcggtg
gcctccgcggtgctcaacgtggccccggaccacctcgactggcacggctcctacgccgag
tacctgcgagccaagggcaagatctacgacaacacccacctggcctgcgtctacaacgtg
gcggacatccagaccgagcagctggtgatggaggctgaggtggtcgaggggtgccgcgcg
gtcggcttcacgaccggaatccccgccccctcgatgatcggcgtcgtcgacgacgtgctc
gccgaccgcgccttcgtggagcagcgccaacggtcggcggcggagctctgcacgctcgac
gacctccgtggcgatgcgccctcggtcgccccgcactaccttgcgaacgcactggcggct
gctgccctcgcccgcgcctacggcgtcggcccgctcgccgttcgcgacggcctacgcgcc
ttccgacccgaccggcatcggatcgcagaggtggccaccgtgcgcggtgtgcgctgggtc
aacgactccaaggccaccaacacccacgcggccgcggcggctctcacctccttcgacagt
gtcgtgtggatcgccggtgggttgctcaagggcgcagacgtggacagcctcgtagaggag
gtggcatcgcggcttcgtggcgtcgtgctcatcggggcagaccgggcccgcatcgcggag
gcgctggcccgacacgcgcccgatgttccggtcatcgacctccccgacaccgacactggg
gtcatggacctcgtcgtcacccatgctgcgcgcctggcgcacccaggggacgtcgtcctg
cttgcgccggctgccgcttcgatggacatgttcaccaactacggcgcgcgcggcgacgcc
ttcgaggatgcggtgcggcgccacctggaggcgagcgggggagacctgtga

DBGET integrated database retrieval system