KEGG   Intrasporangium calvum: Intca_1618Help
Entry
Intca_1618        CDS       T01385                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ica  Intrasporangium calvum
Pathway
ica00071  Fatty acid degradation
ica00280  Valine, leucine and isoleucine degradation
ica00281  Geraniol degradation
ica00310  Lysine degradation
ica00360  Phenylalanine metabolism
ica00362  Benzoate degradation
ica00380  Tryptophan metabolism
ica00410  beta-Alanine metabolism
ica00627  Aminobenzoate degradation
ica00640  Propanoate metabolism
ica00650  Butanoate metabolism
ica00903  Limonene and pinene degradation
ica01100  Metabolic pathways
ica01110  Biosynthesis of secondary metabolites
ica01120  Microbial metabolism in diverse environments
ica01130  Biosynthesis of antibiotics
ica01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Intca_1618
   00650 Butanoate metabolism
    Intca_1618
  Lipid metabolism
   00071 Fatty acid degradation
    Intca_1618
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Intca_1618
   00310 Lysine degradation
    Intca_1618
   00360 Phenylalanine metabolism
    Intca_1618
   00380 Tryptophan metabolism
    Intca_1618
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Intca_1618
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Intca_1618
   00281 Geraniol degradation
    Intca_1618
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Intca_1618
   00627 Aminobenzoate degradation
    Intca_1618
   00930 Caprolactam degradation
    Intca_1618
Enzymes [BR:ica01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Intca_1618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADU48131
UniProt: E6S8Z4
Position
complement(1831471..1832202)
Genome map
AA seq 243 aa AA seqDB search
MLQRALEDDVLVLTLNRPDKRNALNLELCRALWDALDTAGTGDGSVRAVVITGAGSTFCA
GADLDGVYGDDFLEAHYGMLGAITTVPVPVIAAVNGPAIGGGTQLAAACDLRMATAAARF
AVPTARNGLAVDPWTIRRLVHLVGGGHTRGLLLAAETMDLAAALTSGLVQREGDVTDAIA
LAHDLAGLAPLSLAYAKHVLNSPQLADDDPSLRAKFLACFASEDAAEADAARRERRRPVF
RGR
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagcgtgctctcgaggacgatgtcctcgtactcaccctcaaccgccccgacaag
cggaatgccctcaacctggagctgtgccgagctctctgggacgcactcgacacagcaggc
acgggagatgggtcggtccgcgccgtggtcatcaccggggccggctcgacgttctgcgcc
ggggcggacctcgacggcgtctacggcgacgacttcctcgaagcccactacggcatgctc
ggcgcgatcacgaccgtgccggtcccggtcatcgcagccgtcaacggcccggcgatcggg
ggcggcactcagctcgcggccgcctgcgaccttcggatggccacggcggcggcccgcttc
gccgtgccgaccgcacgcaacggcctcgccgtcgacccctggacgatccgccggctggtc
cacctcgtcgggggcgggcacacccgtggcctcctgctggcagccgagacgatggacctg
gccgccgcgctgacgagcgggctcgtgcagcgcgaaggagacgtcaccgacgccatcgcc
ctggcccacgacctcgccggcctggcccccctctcgttggcctacgcgaagcacgtgctc
aactcgccgcagctcgcggacgacgacccttcgctccgggcgaagttcctcgcgtgcttc
gccagcgaggacgcagcagaggcggacgccgccaggcgcgaacgacgccgacctgtcttt
cgcgggcggtga

DBGET integrated database retrieval system