KEGG   Intrasporangium calvum: Intca_2922Help
Entry
Intca_2922        CDS       T01385                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
ica  Intrasporangium calvum
Pathway
ica00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ica00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Intca_2922
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ica01007]
    Intca_2922
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ica03016]
    Intca_2922
Enzymes [BR:ica01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     Intca_2922
Amino acid related enzymes [BR:ica01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Intca_2922
Transfer RNA biogenesis [BR:ica03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Intca_2922
 Prokaryotic type
    Intca_2922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1f tRNA-synt_1 tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: ADU49417
UniProt: E6SAV6
Position
complement(3243595..3245073)
Genome map
AA seq 492 aa AA seqDB search
MSLHLFDTATRELRAFVPRESGKVGMYICGLTTQGAPHIGHIRFAVAFDVLRRWLETAHD
YHVTLIRNVTDIDDKVLRKAADAGEDWFALTYRNERLTTDALDALGVKPATYEPRATGHV
PDMVALMETLIEKGHAYAAPDGSGDVYFDVRSWPDYGSLSNQSLDDMVAAEDADPRGKRD
PRDFALWKGRKSDEPLSASWPTPFGSGRPGWHLECSAMARRWLGDEFDIHGGGIDLRFPH
HENEQAQSRAAGLGFARYWLHNAWVTVKGEKMGKSLGNALEVRHLLEHTRPLVLRYYLTA
AHYRSTIEYHSGSLDEAAAAVERIEGFLERAARRGEITSPTDAAAARAVLPPEFVEAMDD
DLGVSGALAAVHDTVRAGNVALEEGDDDAALAAAVRVVAMTDVLGINPLAPNWATSQDAT
TTAVEVALDALVRARLEERQSARQERDFARADAIRDELAAVGVAITDTPAGAQWALVRTN
GSGPPSGTGKEG
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
gtgagtctccatctgttcgacaccgccacccgtgagctgcgcgcattcgtcccgcgcgag
agcggcaaggtcggcatgtacatctgtgggctcaccacccagggcgcgccgcacatcggc
cacatccgcttcgccgtcgcgttcgacgtcctgcggcgctggctcgagacggcccacgac
taccacgtgaccctgatccgcaacgtcaccgacatcgacgacaaggtgctgcgcaaggcg
gccgacgccggcgaggactggttcgcgctgacctaccgcaacgagcgcctgacgacggat
gccctcgacgcgctgggcgtcaagccggccacgtacgagccgcgcgcgacgggccacgtg
cccgacatggtcgccctgatggagaccctcatcgagaagggccacgcctacgccgcgccg
gacgggtccggtgacgtctacttcgacgtccggtcgtggcccgactacggctccctgtcg
aaccagtcgctcgacgacatggtcgcggccgaggacgccgacccccgcggcaagcgcgac
ccgcgcgacttcgcgctgtggaagggacgcaagtccgacgagccgctcagcgcctcgtgg
cccacgccgttcggttccgggcgccccggctggcacctcgagtgctcggccatggcccgg
cgctggctgggcgacgagttcgacatccacggcggcggcatcgacctgcgcttcccgcac
cacgagaacgagcaggcgcagtcgcgggcggcgggcctcggcttcgcccgctactggctg
cacaacgcctgggtcaccgtcaagggcgagaagatgggcaagtcgctcggcaacgccctc
gaggtgcgccacctgctcgagcacacgcggccgctcgtcctgcgctactacctcaccgcc
gcgcactaccgctcgacgatcgagtaccactcgggctcgctcgacgaggcagccgcggcg
gtcgagcgcatcgagggcttcctcgagcgcgccgcgcgccgcggcgagatcacgtcgccg
accgacgcggcggctgcccgcgcggtcctcccgcccgagttcgtcgaggcgatggacgac
gacctcggcgtctccggagccctcgccgcagtgcacgacacggttcgggccggcaacgtc
gcgctggaggagggcgacgacgacgcggcgctcgcggcggcagttcgagtggtcgcgatg
accgacgtgctcggcatcaacccactggcacccaactgggccacgtcccaggacgcgacg
acgaccgccgtcgaggtggctctcgacgcgctggtccgggcgcggctcgaggagcgtcag
tccgcccgccaggagcgtgacttcgcgcgcgccgatgcgatccgcgacgagctcgcggcc
gtcggtgtcgccatcaccgacacgcccgccggcgcacagtgggcgctcgttcgcaccaac
gggtccggaccgcccagcggcaccggcaaggaaggctga

DBGET integrated database retrieval system