KEGG   Intrasporangium calvum: Intca_3185Help
Entry
Intca_3185        CDS       T01385                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
ica  Intrasporangium calvum
Pathway
ica00040  Pentose and glucuronate interconversions
ica00053  Ascorbate and aldarate metabolism
ica01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ica00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Intca_3185
   00053 Ascorbate and aldarate metabolism
    Intca_3185
Enzymes [BR:ica01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     Intca_3185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADU49669
UniProt: E6SD51
Position
3519198..3520781
Genome map
AA seq 527 aa AA seqDB search
MLLTGQSIIAGTPTAGSGGTFTAVDPSTGAALGPEVSCLTPDEVALATRAAAESCTAYRS
TTPTERAAFLEAIAEEIEALGDELLERAHAETALPLARLQGERARTCGQLRMFAGVVRQG
DHLGVRIDSALPDRAPLPRPDLRLRQIALGPVAVFGASNFPLAFSTAGGDTASALAAGCP
VVVKAHNAHPGTSELVGQAVARAAGRTQMPAGVFSLVFGLGNEVGMALVTDPRIHAVGFT
GSRAGGLALVAAAAGRAQPIPVYAEMSSTNPVILLEGALTGDPTRLATAYLTSLTSGSGQ
FCTNPGLLFLPDGEAGDAFLAAVAEQAAQAAGQTMLTPQIRTAFGAGIERLGAHPSVRTI
AQGVAGAGDNAPAPMVFATELTALAEDHGLTEEVFGAAGLVVRFGDVTRLAEHLADLAGQ
LTATIHATDADHEAAAVLVPVLETRVGRILFNGWPTGVEVTHAMVHGGPFPATSDARSTS
VGSLAIERFQRPVCYQDVPASLLPQPVRDDNPWQLSRRIDGTVEPPQ
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgctcctgacaggacagtccatcatcgccggcactccgaccgcgggctcgggcggcacg
ttcacggccgtcgacccgagcacgggcgcagccctgggcccggaggtctcctgcctcacc
ccggacgaggtggcgctcgccacccgcgccgcggccgagtcctgcaccgcctaccgctcc
acgacgccgactgagcgggcggccttcctcgaggccatcgccgaggagatcgaggccctc
ggcgacgagctgctcgagcgggcccatgccgagacggccctgccgctcgcccgcctccag
ggcgaacgcgcccgcacgtgcggccagctgcggatgttcgccggcgtcgtccgccagggg
gaccacctcggcgtgcgcatcgactcggcgctgcccgaccgcgcgcccctgccccggccc
gacctcaggttgcgccagattgccctggggcccgtcgcggtcttcggcgcaagcaacttt
ccgctcgccttctccacagccggcggcgacacggcctccgcgctggccgccggctgcccc
gtcgtcgtcaaggcgcacaatgcccaccccggcaccagcgagctcgtgggacaggccgtc
gcccgggccgcgggccgcacgcagatgccggccggcgtcttctccctcgtcttcggcctc
ggcaacgaggtcggaatggcgctcgtcaccgacccgcggatccacgcggtcggcttcacc
ggctcccgcgcgggcgggctcgccctcgtcgctgcggcggcaggacgagcccagccgatc
ccggtctacgccgagatgtcgtcgaccaaccccgtgatcctcctcgagggcgccctcacc
ggtgacccgacacgcctggccaccgcctacctcacctccctgacgagcgggtcgggccag
ttctgcaccaaccccggcctgctcttcctgcccgatggtgaggccggcgacgcattcctc
gccgccgtggccgagcaggccgcgcaggccgcgggacagaccatgctcacgccgcagatc
cgcacggccttcggggcgggcatcgagcggctcggcgcccacccctccgtgcggaccatc
gctcagggtgtggccggcgccggcgacaacgctcccgcccccatggtgttcgcgaccgag
ctcaccgcgctggccgaggaccacggcctcactgaggaggtcttcggagccgcgggcctc
gtggtccggttcggtgacgtcactcgcctcgcggagcacctggccgacctcgctggacag
ctcaccgcgaccatccacgccaccgacgccgaccacgaggcggcggccgtcctcgtgccc
gtcctcgagacgcgcgtcggccgaatcctcttcaacggctggccaaccggagtcgaggtc
acccacgcgatggtccacggcggccccttccccgccacctccgacgcacggtccacctcg
gtcgggtcactcgccatcgagcggttccaacggccggtctgctaccaggacgtcccggcg
tccctgctgccccaaccggtccgcgacgacaatccctggcagctgagtcgccgcatcgac
gggacggtcgagccgccccagtga

DBGET integrated database retrieval system