KEGG   Idiomarina sp. X4: CWC33_02740Help
Entry
CWC33_02740       CDS       T05226                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
idi  Idiomarina sp. X4
Pathway
idi00471  D-Glutamine and D-glutamate metabolism
idi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:idi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CWC33_02740
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:idi01011]
    CWC33_02740
Enzymes [BR:idi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     CWC33_02740
Peptidoglycan biosynthesis and degradation proteins [BR:idi01011]
 Precursor biosynthesis
  Racemase
   CWC33_02740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ATZ72672
Position
complement(558713..559459)
Genome map
AA seq 248 aa AA seqDB search
MKVGVFDSGVGGLTVARSLQQSGCFSELLYYGDTARVPYGSKDSNTVTRYALEAVEFFNG
ADVDCLVVACNTVSVTALEQMQKFSNKPVYGVLEPGVMALQQLQGIDTSARVLVIATRST
INSGAYQQQIQALGYSQVDAMPTPLFVPIVEEELYDGPILQETFKHYFGKLDKPDVVLLG
CTHFPLIAESISDYFNGAKTIHSGEAMLAWLKQHLDLSAQFDTTPLHIIATENVDAVKRT
ATRWGLKL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttggagtttttgatagtggtgtgggtggtttaaccgtagcgcgctcactgcag
caaagcggttgtttcagcgagttgctgtattacggagacaccgcccgggtgccctatgga
agcaaggacagcaacaccgtaactcgctacgctctggaagccgtcgagttttttaacggc
gccgatgtggactgcctggtggtggcgtgtaacaccgtgagtgtgactgcattagagcaa
atgcaaaagttctctaataagccggtgtacggcgtgctggaacctggtgtgatggctctg
caacagttgcagggcattgataccagtgcccgggtgctggttattgcgacgcgctcaacg
attaactccggtgcctatcaacagcagatacaggcattgggttatagccaggtagacgct
atgccgacgccgttgtttgtgcctattgttgaagaagagctttacgatggacctatactg
caggaaacctttaagcattatttcggcaaactggacaagccggacgtggtgctgttgggt
tgtacgcatttcccgctgattgccgagagtatttctgactacttcaacggcgccaaaacc
atccattccggcgaagccatgttagcctggctaaagcaacacctggacttaagcgcccag
tttgataccacgccactgcacatcatagccaccgaaaacgtcgacgccgttaagcgcacc
gccacccgttggggcctgaaactgtag

DBGET integrated database retrieval system