KEGG   Idiomarina sp. X4: CWC33_03700Help
Entry
CWC33_03700       CDS       T05226                                 

Definition
(GenBank) 3-deoxy-manno-octulosonate-8-phosphatase KdsC
  KO
K03270  3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase) [EC:3.1.3.45]
Organism
idi  Idiomarina sp. X4
Pathway
idi00540  Lipopolysaccharide biosynthesis
idi01100  Metabolic pathways
Module
idi_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:idi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CWC33_03700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:idi01005]
    CWC33_03700
Enzymes [BR:idi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.45  3-deoxy-manno-octulosonate-8-phosphatase
     CWC33_03700
Lipopolysaccharide biosynthesis proteins [BR:idi01005]
 Unusual sugar
  CWC33_03700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 HAD_2 Hydrolase S6PP HAD
Motif
Other DBs
NCBI-ProteinID: ATZ72851
UniProt: A0A2K8Q3Q6
Position
773553..774107
Genome map
AA seq 184 aa AA seqDB search
MECINTWYGDIEKQLFERFSQVRLLILDVDGVFSDGRIYLGNDGEELKAFHTRDGFGMKA
LKNAGIQTAVITGRQSSIVERRMQHLDVSDIYQGQVDKTQAFNELLTHHSVNAEQTAYVG
DDTPDLPLIQQAGIGVAVKDAHPSIQQQAQYITRCAGGFGAVREVCDLIMLSQGLLHDAK
GASV
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggagtgtattaatacctggtatggggacattgaaaaacaattgtttgagcgtttctca
caggttcggctgttaattctcgacgtcgatggtgttttttcggacggtcgaatatacctt
ggcaacgatggtgaagagctgaaagctttccacactcgggacggctttggtatgaaagca
cttaagaatgcgggcatacagacagccgtcatcaccggtcgccaatccagcatcgttgaa
cgtcggatgcagcatttagacgtgtctgacatctatcagggacaagtcgacaaaacccag
gcatttaatgagcttctgactcatcacagcgtgaatgctgaacagactgcctatgtcgga
gacgacacacccgatcttccgctgatacagcaggccggcattggtgttgcagtaaaagac
gcgcacccttctattcagcagcaagctcaatacattacccgctgtgccggtggctttggc
gcggttcgtgaggtgtgtgacttgattatgttaagccaggggcttttgcatgacgccaaa
ggagccagtgtgtga

DBGET integrated database retrieval system