KEGG   Isoptericola dokdonensis: I598_1466Help
Entry
I598_1466         CDS       T04384                                 

Gene name
araG_2
Definition
(GenBank) Arabinose import ATP-binding protein AraG
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
ido  Isoptericola dokdonensis
Pathway
ido02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ido00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    I598_1466 (araG_2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ido02000]
    I598_1466 (araG_2)
Enzymes [BR:ido01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     I598_1466 (araG_2)
Transporters [BR:ido02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    I598_1466 (araG_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_29 Zeta_toxin TsaE AAA_23 AAA_25 MMR_HSR1 AAA_27 AAA_30 APS_kinase DUF2813 TPR_11 AAA_15
Motif
Other DBs
NCBI-ProteinID: ANC31019
UniProt: A0A168F8A2
Position
complement(1557871..1559409)
Genome map
AA seq 512 aa AA seqDB search
MTSTDPAVRPVVEMTGISVEFPGVKALEQVDLRLFPGEVHALMGENGAGKSTLIKALTGV
YGIDAGDIVVDGEPHLFSGPGEAQAAGVATVYQEVNLCENLTVAENIMLGREPRRLGAID
WRATRREAARHLATMGLDIDPASSLGAHSIAVQQLVAISRAMVVDAKVLILDEPTSSLDA
DEVAQLFAVVRRLRDQGVAILFVSHFLEQVYEISDRMTVLRNGRRVGEYRTSEIDRLQLV
STMIGRTMEVLEDLQVTTDHTVTVEQGATPFLQAVGLGRRGSVQPFDLDVYAGEVVGLAG
LLGSGRTEVARLLAGADHADAGSTRVRGDDVRLRTPRAAIDRGIAFSSENRKAEGVVGDL
TVRENIVLGLQADRGWMRRLPTKQVDEIVAKYVAALNIRPANPDALLRNLSGGNQQKVLL
ARWLATAPQLLILDEPTRGIDVGAKAEIQKLVAELAGQGMAVVFISAELEEVLRLSHRIA
VMRDRVKVAEVVNNGDVGVDDVVELIASGGNH
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcaccgaccccgcggtgcgacctgtcgtcgagatgaccgggatctccgtcgag
ttccccggcgtcaaggcgctcgagcaggtcgacctccgcctcttccccggcgaggtgcac
gccctcatgggcgagaacggcgccgggaagtccaccctcatcaaggcgctcacgggcgtc
tacggcatcgacgccggcgacatcgtcgtcgacggtgagccgcacctcttctccggcccc
ggcgaggcccaggccgcgggcgtcgccacggtgtaccaggaggtcaacctctgcgagaac
ctcaccgtcgccgagaacatcatgctgggccgcgagccccgacggctcggcgccatcgac
tggcgggccacccgccgcgaggccgcccggcacctggccacgatgggcctcgacatcgac
ccggcgtcgtcgctcggtgcgcactccatcgccgtccagcagctcgtggcgatcagccgc
gccatggtggtcgacgccaaggtgctcatcctcgacgagccgacgtcgtcgctggacgcc
gacgaggtcgcccagctcttcgccgtggtgcgccgcctgcgcgaccagggcgtcgcgatc
ctgttcgtgtcgcacttcctggagcaggtgtacgagatctccgaccgcatgaccgtgctg
cgcaacggccgtcgcgtcggggagtaccgcacgtccgagatcgaccggctgcagctcgtg
tcgacgatgatcgggcggacgatggaggtcctggaggacctccaggtcaccaccgaccac
acggtgacggtcgagcagggggcgaccccgttcctgcaggcggtcgggctcggccgccgg
ggcagcgtccagccgttcgacctcgacgtgtacgccggcgaggtcgtcggcctggccggc
ctgctcgggtccggccgcaccgaggtggcgcggctgctcgccggcgccgaccacgcggac
gccgggagcacccgcgtccggggcgacgacgtccggctgcggaccccgcgcgccgcgatc
gaccgcggcatcgcgttctcctcggagaaccgcaaggccgagggcgtcgtcggcgacctc
accgtgcgcgagaacatcgtgctcggtctgcaggcggaccgcggctggatgcgccggctg
ccgacgaagcaggtcgacgagatcgtcgcgaagtacgtcgcggcgctcaacatccgcccg
gcgaacccggacgcgctgctgcgcaacctgtcgggcggcaaccagcagaaggtgctcctg
gcgcggtggctcgccaccgcgccccagctgctcatcctcgacgagccgacccgcggcatc
gacgtcggggcgaaggcggagatccagaagctcgtcgccgagctcgccgggcaggggatg
gcggtggtgttcatctccgccgagctggaggaggtcctgcggctcagccaccggatcgcc
gtcatgcgcgaccgggtcaaggtggccgaggtcgtcaacaatggcgacgtcggcgtcgac
gacgtcgtcgagctcatcgcgagcggagggaaccactga

DBGET integrated database retrieval system