KEGG   Isoptericola dokdonensis: I598_3090Help
Entry
I598_3090         CDS       T04384                                 

Gene name
tagD
Definition
(GenBank) Glycerol-3-phosphate cytidylyltransferase
  KO
K00980  glycerol-3-phosphate cytidylyltransferase [EC:2.7.7.39]
Organism
ido  Isoptericola dokdonensis
Pathway
ido00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ido00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    I598_3090 (tagD)
Enzymes [BR:ido01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.39  glycerol-3-phosphate cytidylyltransferase
     I598_3090 (tagD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like FAD_syn Pantoate_ligase
Motif
Other DBs
NCBI-ProteinID: ANC32605
UniProt: A0A161I3G8
Position
3342620..3343012
Genome map
AA seq 130 aa AA seqDB search
MKRVITYGTYDLLHYGHIELLRRAKALGDYLIVALSSDEFNAGKGKKSYFTFEERRRMLE
AIRHVDLVIPEHTWEQKATDIQLYHVDTFVIGDDWTGKFDELKEVCEVVYLPRTPEISTT
QIKAGLAAKG
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgagtcatcacctacggcacctacgacctgctgcactacgggcacatcgagctg
ctgcgtcgggccaaggcgctgggtgactacctgatcgtggcgctgtcgtcggacgagttc
aacgcgggcaagggcaagaagtcgtacttcaccttcgaggaacgccgccggatgctcgag
gcgatccggcacgtcgacctcgtcatcccggagcacacctgggagcagaaggccaccgac
atccagctctaccacgtcgacaccttcgtcatcggcgacgactggaccggcaagttcgac
gagctcaaggaggtgtgcgaggtcgtctacctgccgcgcacgccggagatctcgacgacg
cagatcaaggccgggctggccgcgaagggctga

DBGET integrated database retrieval system