KEGG   Isoptericola dokdonensis: I598_3276Help
Entry
I598_3276         CDS       T04384                                 

Gene name
mca
Definition
(GenBank) Mycothiol S-conjugate amidase
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
ido  Isoptericola dokdonensis
Brite
KEGG Orthology (KO) [BR:ido00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    I598_3276 (mca)
Enzymes [BR:ido01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     I598_3276 (mca)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: ANC32785
UniProt: A0A161I3N6
Position
3548737..3549633
Genome map
AA seq 298 aa AA seqDB search
MTGETLRLMAVHAHPDDESSKGAATTARYAAEGVEVLVVTCTGGERGDVLNPSFAVPEGH
GFESLEDKRAVRRLEMAAAAEALGVQQRWLGFVDSGLPEGDPLPPLPDGCFALLPLEEAT
APLVELVREFRPHVMTTYDPSGGYPHPDHIRCHEVSVEAYHAAGDPERYVVEGGAAPWEP
LKLYYNHGFSMARLRAAHEAMEGAGLESPFGDWIESRTAREIPEREVTTRVEVADFFDRR
DAALVAHASQIDPGGFFFAVPRDIEVDVWSTEEFELADSRVPTSTPEDDLFAGVRKES
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggtgagacgctgcgcctcatggcggtccacgcccaccccgacgacgagtcgagc
aagggggccgcgacgacggcccgctacgcggccgagggcgtcgaggtgctcgtggtgacc
tgcaccggcggggagcggggagacgtcctgaacccgtcgttcgccgtccccgaggggcac
ggcttcgagtccctggaggacaagcgcgcggtgcgccgcctggagatggcggccgccgcg
gaggcgctgggcgtgcagcagcggtggctgggcttcgtggactccggcctgccggagggc
gacccgctgcccccgctgccggacggctgcttcgcgctgctgccgctcgaggaggcgacc
gcgccgctggtggagctggtgcgcgagttccgcccgcacgtcatgacgacctacgacccc
tcgggcggctacccgcacccggaccacatcaggtgccacgaggtgtccgtcgaggcgtac
cacgcggcgggcgaccccgagcgctacgtggtcgagggcggtgccgccccgtgggagccg
ctcaagctgtactacaaccacggcttctcgatggcgcggctgcgggccgcgcacgaggcc
atggagggcgcgggcctggagtccccgttcggcgactggatcgagtcccgcacggcccgc
gagatccccgagcgggaggtgacgacgcgcgtcgaggtggccgacttcttcgaccggcgg
gacgccgcgctcgtcgcgcacgcctcgcagatcgacccgggcgggttcttcttcgcggtc
ccgcgcgacatcgaggtggacgtctggtccaccgaggagttcgagctcgcggactcgcgc
gtgccgacgtcgacgccggaggacgacctgttcgccggtgtccggaaggagagctga

DBGET integrated database retrieval system