KEGG   Idiomarina sp. OT37-5b: C5610_00760Help
Entry
C5610_00760       CDS       T05379                                 

Definition
(GenBank) low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
idt  Idiomarina sp. OT37-5b
Pathway
idt00260  Glycine, serine and threonine metabolism
idt01100  Metabolic pathways
idt01110  Biosynthesis of secondary metabolites
idt01120  Microbial metabolism in diverse environments
idt01130  Biosynthesis of antibiotics
idt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:idt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C5610_00760
Enzymes [BR:idt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     C5610_00760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AVJ54952
UniProt: A0A2S0IHG5
Position
complement(164487..165506)
Genome map
AA seq 339 aa AA seqDB search
MKRLDLRSDTVTQPTPAMREAMANAPVGDDVYGEDPTINALEQRVATMLGKESALLCASG
TQSNLCGLLAHCRNGEEYIVGQEYHTYRYEAGGAAVVGGIVPQPLEVQADGTLDLDVLVS
RIKPDDPHFPITRLLAFENTHAGKVIDQAYFNTARRIADQHGLAMHLDGARLANAVVASD
RSFAELAAPFDSVSICCSKGLGAPVGSLLVGNADFIARARRWRKMVGGGMRQAGVIAAAI
DYALDHHIERLKQDHANAAWLAEELAGIAGQHAITTHPAQTNMVYLELPSAELGLQLQQF
MAQRNIVIPSGKKLRLVTHLNAERPMLEQFISSFAEFLR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgcctcgatttacgcagtgataccgttacccaacccacacccgcgatgcgtgag
gctatggcaaatgcgccagtcggcgatgatgtttacggagaggatcccaccatcaatgcg
ctggaacaacgcgttgccaccatgctcggcaaagagtcagccctgctttgtgcgtcagga
acccaaagtaatttgtgcggcctgttagcccattgccgcaacggcgaagaatatatcgtc
gggcaggaataccacacctaccggtatgaagctggcggtgcagccgttgttggtggcatc
gtgcctcaaccattagaagtgcaggcggacggtacgctcgacctggacgttctggtcagc
cgcattaagcctgatgatccgcacttcccgattacccgtctactggcgtttgaaaacacc
catgccggcaaggtgattgatcaggcctactttaatacagctcgccgcattgccgatcaa
catggcttagcaatgcatttggacggcgcccgtctcgccaatgcagtggtagcatccgat
cgaagctttgccgagcttgcggcaccgttcgacagcgtatcgatttgctgctcaaaaggc
ttaggcgctccagtgggatcgttactggtgggcaacgctgattttatcgcccgcgcgcga
cgctggcgtaaaatggtcggcggtggtatgcgtcaagcaggcgtaattgctgcggctatc
gactacgcgttggatcaccatatcgaacgtcttaaacaagaccatgcgaacgcggcctgg
cttgctgaagaactggccggtattgctggccaacacgctatcaccacccatccggcacaa
accaacatggtctatcttgaactgccatcagcggaactgggcttgcagctacaacagttt
atggcgcaacgcaatatcgttatcccgagcgggaaaaagctgcgcctggtcacgcacttg
aatgcggagcggccgatgcttgaacaatttatcagcagttttgcagaatttttacgctaa

DBGET integrated database retrieval system