KEGG   Idiomarina sp. OT37-5b: C5610_07090Help
Entry
C5610_07090       CDS       T05379                                 

Definition
(GenBank) Fe/S-dependent 2-methylisocitrate dehydratase AcnD
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
idt  Idiomarina sp. OT37-5b
Pathway
idt00640  Propanoate metabolism
idt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:idt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C5610_07090
Enzymes [BR:idt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     C5610_07090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AVJ56097
UniProt: A0A2S0IKT4
Position
complement(1527501..1530098)
Genome map
AA seq 865 aa AA seqDB search
MNSEYRKTLNGTTLEYFDTRAAVEAIEPGAYDKLPYTSRVLAENLVRRCPPEILTQSLEQ
LIYRKREHDFPWFPARVVCHDILGQTALVDLAGLRDAIAEKGGDPAKVNPVVPTQLIVDH
SLAVEHAGFEKDAFEKNRAIEDRRNDDRFHFINWTKTAFKNVDVIPPGNGIMHQINLEKM
SPVVQVRDNVAFVDTCVGTDSHTPMVDALGVISVGVGGLEAESVMLGRASYMRLPDIVGV
ELTGKLRPGITGTDLVLALTEFLRRERVVGAYLEFFGEGADALTVGDRATISNMTPEYGA
TAAMFYIDEQTIDYLKLTGRDDDQVALVEKFAKETGLWSDSLKHVEYERVLRFDLSKVER
NLAGPSNPHALLPAAELSARGVAKHIEQPEDGKMPDGAVIIAAITSCTNTSNPRNMIAAG
LIARNANKLGLTRKPWVKSSLAPGSKTVKMYLEEAELLPELESLGFGVVAFACTTCNGMS
GALDPNIQQEIIDRDLFSTAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTIRFDI
EKDVLGYDPDGNPVTLKDIWPSDEEIDQIVKQSVKPEQFRKVYDPMFNLSVDYGDKTNPL
YDWRPMSTYIRRPPYWEGEFVSENTLKGLRPLAVLGDNITTDHLSPSNAIMADSAAGEYL
AKMGVPEEDFNSYATHRGDHLTAQRATFANPKLFNEMVRDENGEVIQGSLARIEPEGQVV
RMWEAIEHYMEKKQPLIIVAGADYGQGSSRDWAAKGVRLAGVEVIVAEGFERIHRTNLIG
MGVLPLQFEAGTTRKTLNIDGTETFDVKGTPAAGAELTLVIHRANGEQLEVPVQCRLDTK
EEVSIYEAGGVLQRFAQDFLEAEAV
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atgaattctgaataccgtaaaacgctaaacggtaccacgctcgagtatttcgatactcgg
gcagccgttgaagcgattgaacccggcgcctacgataaattgccttatacgtcgcgggtg
ttagcagaaaatctggtgcgtcgttgtccaccggaaattttgacacaatccctcgagcag
ttaatttatcgtaaacgcgaacatgattttccatggtttccggcacgcgttgtttgtcat
gacattttgggtcagacggcgttggtggatttggccggtctgcgtgatgccatcgctgag
aagggcggtgatccggccaaagtgaacccggtagtaccgacgcagttgatcgtcgaccac
tcgctcgcggttgaacacgccggttttgaaaaagacgcctttgaaaagaaccgtgcgatc
gaagaccgccgtaacgacgaccgttttcattttattaactggactaaaaccgcgtttaaa
aacgtggatgttattccgcccggtaacggcatcatgcaccagatcaacctggagaagatg
tcgccggtggtgcaagttcgcgataacgtcgcgtttgtcgacacctgtgttggtacagac
agtcacaccccgatggtggacgcgctgggcgtgatttcggtcggtgttggcggcttagaa
gctgaaagcgtgatgcttggccgcgcatcctacatgcgcctgccggacatcgtcggtgtc
gaattaaccggcaagttacgtccgggcatcaccggtaccgacttggtattggcattaacg
gagttcttgcgccgcgagcgcgtggtgggtgcctacctggaattctttggagagggtgct
gacgcactgacggttggtgatcgtgcaaccatctccaatatgactccggagtacggtgca
acggcggcgatgttctatatcgacgagcagaccattgattacctgaaactgacgggtcgt
gatgatgaccaggttgcgctggttgagaaatttgcgaaagaaacgggtctgtggagtgac
agcctgaagcatgttgagtacgaacgtgtgctgcgttttgacctgtcgaaggttgaacgt
aatctggccggaccgtcgaacccgcacgcgttgttgccggcggctgaattaagtgctcgt
ggcgtagccaagcacattgagcagcccgaagacggcaaaatgcctgatggtgccgttatc
attgcggcgatcacaagctgtaccaataccagtaacccccgtaacatgattgcggctggc
cttattgcccgcaacgccaataagctgggactaacccgtaaaccgtgggtaaaatcctcg
ttagcaccgggttcgaaaaccgtaaaaatgtacctggaagaagcggagctgctaccagag
ctggagagtctgggctttggcgtggtcgcgtttgcctgtaccacgtgtaatggtatgagt
ggggcgttggatccgaacatccaacaggaaatcatcgaccgtgacttgttctcgacggcg
gtgctgtcgggtaaccggaactttgacggccgtattcacccgtatgccaaacaggctttc
ctggcttcaccacccttggtggtcgcctacgccattgccggaaccattcgctttgatatc
gaaaaagacgttctgggctatgatcccgatggcaatccggtgacgctgaaagatatttgg
ccaagcgatgaagaaattgaccaaatcgtcaaacaaagcgttaagccggagcagttccgc
aaagtttatgacccgatgtttaacctgagcgtggactacggtgataagaccaacccactg
tacgactggcgtccaatgagcacctatattcgccggccgccatactgggaaggtgaattt
gtcagtgagaacacgctgaaaggactgagaccgttagcggtactgggtgataatatcacc
accgatcacttgtcgccgtcgaatgccatcatggccgacagcgccgccggagagtacctg
gcgaaaatgggtgtgccggaagaagactttaactcctacgccacccaccgtggcgatcac
ttgaccgcacagcgcgcaaccttcgcgaatccgaagctgtttaacgaaatggttcgcgat
gagaacggcgaggtgatacagggctcgctggcgcggatcgagccggaaggccaagttgtg
cgtatgtgggaagccattgagcactatatggagaagaagcaaccgctgatcattgttgcc
ggtgccgattatggccagggttcctcacgggactgggcggcgaaaggtgtacgcctggcc
ggcgtcgaggtgattgtggcggaaggcttcgaacggatccatcgtaccaacctgattggt
atgggcgttctaccgttgcagttcgaagcgggtaccacgcgtaaaacgctgaacatcgac
ggaaccgaaacctttgatgtgaaaggcacgcctgccgccggtgccgaattgaccttggtt
attcatcgtgccaatggcgagcagttggaggtgccggttcaatgccgtctggacaccaaa
gaagaggtttctatctacgaagccggtggtgttctgcagcgctttgcccaggacttttta
gaagccgaggctgtttaa

DBGET integrated database retrieval system