KEGG   Ignicoccus hospitalis: Igni_0179Help
Entry
Igni_0179         CDS       T00587                                 

Definition
(GenBank) non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
iho  Ignicoccus hospitalis
Pathway
iho00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:iho00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Igni_0179
Enzymes [BR:iho01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     Igni_0179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: ABU81363
UniProt: A8A8W1
Position
159259..159825
Genome map
AA seq 188 aa AA seqDB search
MVSKKVYFLTSNPHKAKEVSDVLSQFSIEVVPLKGEKLEIQADSVEEVARFAAEEAKKRF
KERPLLLEDSGLFVDALKGFPGPYSNYVYRTLGLEGLLKLMEGVEDRRARFVCAAALVKE
DDKIVIEVGEVEGEIAYEPRGDKGFGFDPIFVPLGYEKTFAELGEEVKKRISHRARAFMK
IAKHLSGE
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaagaaggtttacttcctaacctctaaccctcacaaggcgaaggaagttagt
gacgtgctcagccagttctcgatcgaggtggtccctctgaagggcgagaagttggagata
caagcggactccgtggaggaggtggcgaggttcgcggcggaggaggccaagaagaggttc
aaggagaggccgttgctcttggaggacagcgggctcttcgtggacgctctgaagggcttc
ccggggccgtacagcaactacgtttatcgaactctggggttggaggggctgttgaagctc
atggaaggggttgaggacaggagggcgcgcttcgtctgcgctgctgcgttagtgaaggag
gacgataagatcgttattgaggtaggagaggttgagggcgaaatagcttacgagccgagg
ggggataagggcttcggcttcgacccgatcttcgttcccctcggctacgagaagaccttc
gccgagctgggggaggaggtgaagaagaggatttcccacagggcgagggcgttcatgaag
atagctaaacacttgtccggggaataa

DBGET integrated database retrieval system