KEGG   Ignicoccus hospitalis: Igni_0247Help
Entry
Igni_0247         CDS       T00587                                 

Definition
(GenBank) SSU ribosomal protein S12P
  KO
K02950  small subunit ribosomal protein S12
Organism
iho  Ignicoccus hospitalis
Pathway
iho03010  Ribosome
Module
iho_M00179  Ribosome, archaea
Brite
KEGG Orthology (KO) [BR:iho00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Igni_0247
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:iho03011]
    Igni_0247
Ribosome [BR:iho03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    Igni_0247
  Bacteria
    Igni_0247
  Archaea
    Igni_0247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosom_S12_S23
Motif
Other DBs
NCBI-ProteinID: ABU81431
UniProt: A8A929
Position
214789..215232
Genome map
AA seq 147 aa AA seqDB search
MPGKKAPNGLFAARKLERKRLKFRWSQREFKRRMLKLKEKYDPLEGAPMARGIVLEKVGV
EARKPNSAVRKCVRVQLVKNGKVVTAFVPGDGGLNVISEHDEVVIVGIGGPRGRSMGDIP
GVRYKVVLVNGVSLDAILKGKKQKPVR
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgcccggtaagaaagctcccaacggactgttcgcggctaggaagctggagaggaagagg
ctcaagttcaggtggagccagagggagttcaagaggaggatgttgaagctcaaggagaag
tacgacccactggaaggggctccaatggcacgcgggatagtcctcgagaaggtaggcgtg
gaggcgcgtaagcctaactccgcagtgaggaagtgcgtgagggtgcaattggttaagaac
gggaaggtagtaacggccttcgtgcccggggacggcggcctcaacgtgatatccgaacac
gacgaggtggtgatagtcggcataggagggcccagagggaggtcgatgggtgacatcccg
ggagttaggtacaaagtcgtgctggtgaacggggtatccttggacgccatcctgaagggt
aaaaaacagaagcccgtgaggtaa

DBGET integrated database retrieval system