KEGG   Ignicoccus hospitalis: Igni_0315Help
Entry
Igni_0315         CDS       T00587                                 

Definition
(GenBank) acetylornithine deacetylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
iho  Ignicoccus hospitalis
Pathway
iho00300  Lysine biosynthesis
iho01100  Metabolic pathways
iho01120  Microbial metabolism in diverse environments
iho01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:iho00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Igni_0315
Enzymes [BR:iho01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Igni_0315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ABU81498
UniProt: A8A996
Position
complement(271268..272425)
Genome map
AA seq 385 aa AA seqDB search
MSPQEVLDLLSQLISFDTVSPEGKQYEDLVHFLKGWLEERGVSAKVEYVDDEYRSSHCPQ
GPKPLLFAWVGEGEPLLEFNGHYDVVPPGDGWEGNPFEPKVVGEYLVGRGATDMKGGVAA
VAASLAELSNWKGNKVQAVFVPDEEVGGRCGTGYRVSKLKEKYEIPRRVVVAEPTDHNVW
IGHKGVVWLRVEVPGKQVHASTPWMGENAFVKASALVLELNRALTDKFSKRYSKYEYSPE
HPLTKFNAFNIGGVAYSTSNKENVVPGSFVFSVDVRVIPEEDEREVVEFVKEVIGDRAKV
EVKLLEPGILNENSELAKLINEVWGEPLKVHKAASDMRYYRGYDVVTWGPGDHRESHTPN
EKIKISEVVEFVGRYARLAKLLAGG
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
ttgtccccccaagaggtcttggacctcctctcccaactcatctccttcgacaccgtctcc
cccgaaggcaagcagtacgaggacttggtccacttcctcaagggctggctggaggagagg
ggagtcagcgctaaggttgagtacgtggacgacgagtataggagctcccactgcccccaa
ggccccaagcccttgctcttcgcttgggtgggcgagggggagcccttactcgagttcaac
ggccattacgacgtggtccctcccggcgacgggtgggaggggaaccccttcgagcccaag
gtggtgggcgagtacttggtgggacggggggccacggacatgaaggggggtgtggcggca
gttgctgcttccctcgcggagctctcgaactggaagggtaacaaggtgcaagcggtcttc
gtgccggacgaggaagttggggggaggtgcgggaccgggtacagggtgagcaaactgaag
gagaagtacgagatcccgaggagggtcgtagtggccgagcccacggaccacaacgtgtgg
ataggccacaagggggtggtttggctgagagtggaagtgccggggaagcaagtgcacgct
tccacaccctggatgggggaaaatgcctttgtgaaggcttctgctttggtattggagctc
aatagggccctcacggacaagttttccaagaggtacagcaagtacgaatactcgccggaa
catccgctgacgaagtttaacgcattcaacataggtggagtggcgtactccacatcaaac
aaggagaacgtggtgcccggttctttcgttttcagcgtggacgtgagggtgatcccggag
gaggacgagcgcgaggtcgtggagttcgtaaaggaagtaataggggatagggcgaaggta
gaggtaaagctcctagagcctggaatattgaacgagaacagcgagctggccaaactgata
aacgaggtgtggggcgagccgctgaaggtccacaaggcggcctccgacatgaggtactat
aggggatacgacgtcgtcacttgggggcccggcgaccacagagagtcccacacgcccaat
gagaagataaagataagtgaggtcgtggagttcgtggggcgttacgcgcggctggcgaag
ctcctagccgggggctag

DBGET integrated database retrieval system