KEGG   Ignicoccus hospitalis: Igni_0683Help
Entry
Igni_0683         CDS       T00587                                 

Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
iho  Ignicoccus hospitalis
Pathway
iho00860  Porphyrin and chlorophyll metabolism
iho01100  Metabolic pathways
iho01110  Biosynthesis of secondary metabolites
iho01120  Microbial metabolism in diverse environments
Module
iho_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:iho00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Igni_0683
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:iho01007]
    Igni_0683
Enzymes [BR:iho01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     Igni_0683
Amino acid related enzymes [BR:iho01007]
 Aminotransferase (transaminase)
  Class III
   Igni_0683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABU81865
UniProt: A8AAB3
Position
615235..616506
Genome map
AA seq 423 aa AA seqDB search
MDRSLELFQIAKNLFPGGVNSPIRAAVKPYPFYVKKASGATLVTVDGVELIDYVLGYGPL
ILGHMHPKVLEAVEEQLNRGWLYGTPHELEIELAKKIVSHYPSIDMVRFVNSGTEATMTA
IRLARGFTKKNKIIKFDGCYHGAHDSVLVKAGSAVSHFGVPGSAGVPEEVSKLTLVVPFN
DVEAVEKVAKENQDDLAAIIVEPVMGNAGVIPPKEGFLKELRRIADETGALLIFDEVITG
YRLGLGGAQAKFGVVPDLTTLGKIVGGGFPVGVVGGKREIMEYLTPSGPVFNAGTFNAHP
VTMAAGLATINELERGYVYEVANSAAEKVAKALEQEAVAKFGGVVHRVASMFQWFPGVEE
VNNYADALKANKEISLRLHEELLKRGVFIAPSLFEAWFTSAAHGEDVVNKTLEALSEALK
VIS
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtggaccggtcgctcgagctcttccaaattgcaaagaacttgttcccgggaggggtgaac
agccccataagggctgctgtaaaaccgtatccgttttacgtaaagaaggccagcggcgcc
actttagtgactgtcgacggcgtagaactaattgactacgtactgggttacggcccctta
atactaggtcacatgcaccctaaggtcttggaagcggtggaagagcaactgaacagaggc
tggttgtacggtaccccccacgaactcgagatagagctagcaaagaagatagtgagccat
tacccctctattgatatggttaggttcgtgaattcggggactgaagcgacgatgaccgcc
ataaggctggccaggggtttcactaagaagaacaaaataatcaagttcgacggctgctac
cacggagcacacgactccgtcttagtcaaggccggctcggccgtctcgcacttcggggtc
cccggctccgccggcgtcccagaggaggtgagcaagctaaccttggtggtgcccttcaac
gacgttgaagcggtagagaaggtggccaaggagaatcaagacgacttggccgctataatt
gttgaaccggtgatggggaatgccggcgtaatccctcccaaggagggcttcctcaaggag
ttgaggaggatcgccgatgagaccggcgcgctcttgatcttcgacgaagtgatcaccggg
tacaggctgggcttgggtggcgcccaagcgaagttcggcgtagtaccggatctaactacc
ttaggcaagatagttggcggaggcttcccggtaggcgtcgtcggaggtaagagggagatc
atggaatacctaaccccctctggcccagtgtttaacgccggcacgttcaacgcgcacccc
gtaactatggcagcggggctcgcgactatcaacgaactcgagagggggtacgtctacgag
gtcgccaacagcgcggcagaaaaggtggccaaggcgttggaacaagaagcggtggccaag
ttcgggggcgtagtgcacagagtggccagcatgttccagtggttccccggggtggaagaa
gttaacaactacgccgacgccttgaaggccaacaaggaaatctcgttaaggctgcacgag
gaacttctgaagagaggagtattcatagcgccgagcttgttcgaagcgtggttcacctcc
gcggctcacggggaggacgtggtcaacaagacgttggaggccttatccgaagcgctaaag
gtgatatcttga

DBGET integrated database retrieval system