KEGG   Ignicoccus hospitalis: Igni_0877Help
Entry
Igni_0877         CDS       T00587                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
iho  Ignicoccus hospitalis
Brite
Enzymes [BR:iho01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Igni_0877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 GCD14 RrnaAD Ubie_methyltran Fibrillarin Methyltransf_11 Methyltransf_3 Methyltr_RsmB-F Methyltransf_23 Methyltransf_4 Methyltransf_32 Methyltransf_24 Methyltransf_12 GidB DUF938 CMAS ACP_syn_III_C LytR_C MTS Methyltransf_21 DREV
Motif
Other DBs
NCBI-ProteinID: ABU82059
UniProt: A8AAV7
Position
complement(778559..779194)
Genome map
AA seq 211 aa AA seqDB search
MEEKKRELIRNLIAEGYIKRKEVAEAMMKVPRELFVPEELRHMAYEDTPLPIGAGQTISA
PHMVAYMVEAAELRRGDKVLEVGTGSGYHAAVMAELVGPEGHVYTIERIPELAERARERL
KALGYNNVTVLVGDGSKGYPPAAPYDKIIVTAAAKRVPEALLKQLKVGGIMVIPVEEEPG
YQVLYKIIKTPEGYVIKKLLPVAFVPLIEEE
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
ttggaggagaagaagagggaattgataaggaacttgatcgctgaaggttacataaagagg
aaggaagtagccgaagcgatgatgaaggtgcccagggagctgttcgttccggaggagctc
cgacacatggcctacgaggacaccccccttccgataggggcgggacagacgataagtgcg
ccccacatggtcgcttacatggtcgaggctgccgagctgcggaggggcgacaaggtccta
gaggtgggcacgggttctggctaccacgcggccgtaatggcagagctggtggggccggag
ggccacgtttatactatagagaggatccccgagctcgccgagcgcgcgagggagaggcta
aaggcgttgggatacaacaacgtcaccgtgctggtgggcgacggaagcaagggctacccg
cccgccgccccttacgataagataatagtaactgccgcggcgaagagggttccagaggcc
ctcttgaagcagctcaaggtggggggaataatggtgatcccagtggaggaggagccggga
tatcaagtactctacaagataatcaagactccggagggatatgtaataaagaagctgctg
cctgtagccttcgtacctttaatcgaggaggagtag

DBGET integrated database retrieval system