KEGG   Ignicoccus hospitalis: Igni_1001Help
Entry
Igni_1001         CDS       T00587                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
iho  Ignicoccus hospitalis
Pathway
iho00010  Glycolysis / Gluconeogenesis
iho01100  Metabolic pathways
iho01110  Biosynthesis of secondary metabolites
iho01120  Microbial metabolism in diverse environments
iho01130  Biosynthesis of antibiotics
iho01200  Carbon metabolism
iho01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:iho00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Igni_1001
Enzymes [BR:iho01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Igni_1001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N Sacchrp_dh_NADP Semialdhyde_dh NAD_binding_3 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ABU82180
UniProt: A8AB78
Position
890769..891827
Genome map
AA seq 352 aa AA seqDB search
MSVKVAVNGFGTIGKRVAEAVLKQDDMTLVGVTKTKPDYLAMIASRMGSLYVPEDRVEKF
QKAGIEVQGTLKDLLEKVDLVVDATPGGVGKEYKPLYEKFGVKAIFQGGEKHEVAGFSFS
TLCNYEEAEGKQFARVVSCNTTGLLRLICALRNHFKVKSVRATIIRRGADPAETKKGPIN
AIVPNPVTLPSHHGVDVRTVLPDLDVQTVAAVVPTTIMHSHVLNVRFEEPVTREDVLKVL
EEAPRILVIPSELSGVKDTAKIIELARDVGRKRYDLYELAIYEESVSVEGDELFLMQAVH
QESIVTPENVDAIRALTGLVSKEESLKKTDSTLGIVRSFSELIERAASNYGK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgttaaggtcgcagtcaacggcttcggtactataggcaagagggtagctgaggcc
gtactaaaacaagacgacatgaccctcgtgggggtcacgaagaccaagccggattacttg
gcaatgatagcctcccgcatgggctcgctctatgtgcccgaagacagggtagagaagttc
cagaaggctggaatagaggtacaaggaaccttgaaggacttgctcgagaaggtcgacctc
gtcgtcgacgccaccccagggggcgtgggtaaggagtacaagcccctctacgagaagttc
ggagtgaaagccatattccaaggcggtgagaaacacgaggtcgcgggcttctcgttctcg
acgctgtgcaactacgaggaggcggaggggaagcagttcgccagggtggtgtcttgtaac
accaccggcctgttgaggctcatatgcgcgttaagaaaccacttcaaagtgaagagcgtc
agggcgaccataattaggaggggggccgatccggcggagactaagaagggacccataaac
gccatagtccccaacccggttaccttgcccagccaccacggcgtggacgtcagaacggtc
ttgccggacttggacgtccagacggtcgccgcggtggtgccgactacgataatgcactcg
cacgtactgaacgtgaggttcgaggagcccgtgaccagagaggacgtcttgaaggttctt
gaagaagctcccaggatactggtaatcccctccgaactgagcggggtgaaggacaccgct
aagataatcgaactcgccagggacgtcgggaggaagaggtacgacttatacgagctggcg
atatacgaggagagcgtgagcgtggagggcgacgagctgttcctcatgcaagccgtccac
caagaaagcatagtcaccccggagaacgtagatgcaattagggccctcacgggcttggtc
agcaaggaagagagcctgaagaagaccgactccaccttaggtatagtcagatccttctcg
gagctgatagaacgtgcggcttccaactacggtaagtaa

DBGET integrated database retrieval system