KEGG   Ignicoccus hospitalis: Igni_1256Help
Entry
Igni_1256         CDS       T00587                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
iho  Ignicoccus hospitalis
Pathway
iho00010  Glycolysis / Gluconeogenesis
iho00020  Citrate cycle (TCA cycle)
iho00620  Pyruvate metabolism
iho00633  Nitrotoluene degradation
iho00640  Propanoate metabolism
iho00650  Butanoate metabolism
iho00680  Methane metabolism
iho00720  Carbon fixation pathways in prokaryotes
iho01100  Metabolic pathways
iho01120  Microbial metabolism in diverse environments
iho01130  Biosynthesis of antibiotics
iho01200  Carbon metabolism
Module
iho_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:iho00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Igni_1256
   00020 Citrate cycle (TCA cycle)
    Igni_1256
   00620 Pyruvate metabolism
    Igni_1256
   00640 Propanoate metabolism
    Igni_1256
   00650 Butanoate metabolism
    Igni_1256
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Igni_1256
   00680 Methane metabolism
    Igni_1256
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Igni_1256
Enzymes [BR:iho01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Igni_1256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: ABU82432
UniProt: A8ABY0
Position
1119623..1120192
Genome map
AA seq 189 aa AA seqDB search
MGPPQMSLVEIRWHGRGGQGAVTASEIVAKAAIAQGKYAQAFPSFGVERRGAPVEAFTRI
DEKPIYIRSKIYEPDIIVVLDPSLLGPKLAEGLKEGGMAIVNTEKTPDEVRKLLGREDVK
VAVVNATKIALETLKRPIVNTAILGAFAKATGLVDLDALLEAVKEKVPPRTVEANLEAVR
RAYEEVVMG
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
gtgggtcctccccagatgtctctcgtagagatcaggtggcacgggaggggcggccaaggg
gccgtgacggcctccgagatagttgctaaggccgctatagcccaagggaagtacgcccaa
gcgttcccgtccttcggagtggagaggaggggcgcgccggtggaggcgttcaccaggata
gacgagaaaccgatatacattaggtctaagatatatgaaccagacatcatagtcgtgctc
gatccgtccctcctcggccccaagctggccgaggggttgaaggaaggaggcatggctatt
gtaaacaccgaaaagaccccggacgaggtgaggaagctcctagggagggaagacgttaag
gtagctgtggtgaacgccactaagatagccctagagaccttaaagaggccgatagtcaat
actgcgatactgggagccttcgctaaggctaccggactcgttgacttagacgccctattg
gaggcggttaaggaaaaagttccccccagaacggtggaggcgaacttggaagccgtcagg
agggcctatgaggaggtggtcatgggatga

DBGET integrated database retrieval system