KEGG   Ignicoccus hospitalis: Igni_1257Help
Entry
Igni_1257         CDS       T00587                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
iho  Ignicoccus hospitalis
Pathway
iho00010  Glycolysis / Gluconeogenesis
iho00020  Citrate cycle (TCA cycle)
iho00620  Pyruvate metabolism
iho00633  Nitrotoluene degradation
iho00640  Propanoate metabolism
iho00650  Butanoate metabolism
iho00680  Methane metabolism
iho00720  Carbon fixation pathways in prokaryotes
iho01100  Metabolic pathways
iho01120  Microbial metabolism in diverse environments
iho01130  Biosynthesis of antibiotics
iho01200  Carbon metabolism
Module
iho_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:iho00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Igni_1257
   00020 Citrate cycle (TCA cycle)
    Igni_1257
   00620 Pyruvate metabolism
    Igni_1257
   00640 Propanoate metabolism
    Igni_1257
   00650 Butanoate metabolism
    Igni_1257
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Igni_1257
   00680 Methane metabolism
    Igni_1257
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Igni_1257
Enzymes [BR:iho01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Igni_1257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_7 Fer4_10 Fer4_9 Fer4_6 Fer4_16 Fer4_2 Fer4_4 Fer4_13 Fer4_17 Fer4_8 ETF_QO Fer4_15 Fer4_22
Motif
Other DBs
NCBI-ProteinID: ABU82433
UniProt: A8ABY1
Position
1120189..1120497
Genome map
AA seq 102 aa AA seqDB search
MMEERLPGWKELPEGAVVRDAGNTETIDVSGWRVFKPVIIDEKCTRCRLCWIYCPDGAII
EVIDEKAKMGKRYEVDYMHCKGCGICYAECPVNAIEWVPEER
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgatggaggagaggcttcccggttggaaggagctcccagaaggggccgtggtaagggac
gcgggcaacaccgaaaccatagacgtgagcggctggagggtcttcaagcccgtaataatt
gacgagaagtgcacgaggtgtaggctgtgttggatctactgtcccgacggcgcgataata
gaggtcatcgacgagaaggctaagatggggaagaggtacgaggtagactacatgcactgt
aagggttgtggtatttgttacgccgaatgtccggttaacgcgatcgaatgggtcccggag
gagaggtga

DBGET integrated database retrieval system