KEGG   Ignicoccus hospitalis: Igni_1361Help
Entry
Igni_1361         CDS       T00587                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
iho  Ignicoccus hospitalis
Pathway
iho00010  Glycolysis / Gluconeogenesis
iho00052  Galactose metabolism
iho00500  Starch and sucrose metabolism
iho00520  Amino sugar and nucleotide sugar metabolism
iho00521  Streptomycin biosynthesis
iho01100  Metabolic pathways
iho01110  Biosynthesis of secondary metabolites
iho01120  Microbial metabolism in diverse environments
iho01130  Biosynthesis of antibiotics
iho01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:iho00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Igni_1361
   00052 Galactose metabolism
    Igni_1361
   00500 Starch and sucrose metabolism
    Igni_1361
   00520 Amino sugar and nucleotide sugar metabolism
    Igni_1361
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Igni_1361
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Igni_1361
Enzymes [BR:iho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Igni_1361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase Pan_kinase
Motif
Other DBs
NCBI-ProteinID: ABU82537
UniProt: A8AC85
Position
1216887..1217798
Genome map
AA seq 303 aa AA seqDB search
MDYLNSEAFDERPVGVADVGGTKTRVALYENDSLKELEEFPTPKEEPLWKPLWSYFKDKE
VQNIVIATMGPLKMSEGKVVSNPHSQIKDQEVGRPLMERLKIPVLVINDCVAGAYAEFKA
RNVENLVYLAFGTGVGAGAVVDGRLLLGREGNAHEVGHFVMSLGLGLRCGCGKTDHAEAV
LGGSNIVNYFKREGFEARNAAELFNLIRSNPKAFELFKRALNSFVSSVIAFYDPEVVVLG
GGVFSKNKKVFFSALEELEDYLLWEAPKVEEALYGELSPLYGAGALGVERPQWLIKKLRY
VFK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtggactaccttaatagtgaggcgttcgacgaaaggccggttggcgttgcagacgtcggg
ggcaccaagaccagggtagccttgtatgaaaacgactccttaaaggagctggaggagttc
ccgacccctaaagaggagcccctctggaagcctctttggagctacttcaaggataaagaa
gtccaaaatatcgtgatagctaccatgggacccctaaagatgagcgagggaaaggtggtc
tctaatccccattctcaaattaaagatcaagaggtcgggaggcccttaatggaacgcttg
aagattccggtcttggtgatcaacgactgcgtcgcgggggcttacgcggagttcaaggcg
aggaacgtggagaacttagtctacttagcctttggcaccggagtgggggccggcgccgtc
gtagacgggaggctcttactagggagggagggcaacgcccacgaggtcgggcacttcgtc
atgtccttaggcctcgggttgaggtgtgggtgcggtaagacggaccacgccgaggcggtg
ttgggcggaagtaacatagtaaactatttcaagagggaaggcttcgaggcccggaacgcg
gccgagctgttcaaccttatcagatctaacccaaaggccttcgaacttttcaagagggct
ttgaactcgttcgtcagctcggtgatagctttctacgatccggaggtagtggtcctagga
gggggcgtgttttcaaagaataagaaggttttcttctctgcgctggaggaactggaggac
tacttgttgtgggaagccccgaaagtcgaagaagccctctacggcgagctgagccccctc
tacggggcgggagctttaggagtagagaggccccagtggttaataaagaagttgaggtat
gtgttcaagtag

DBGET integrated database retrieval system