KEGG   Idiomarina loihiensis GSL 199: K734_03635Help
Entry
K734_03635        CDS       T02681                                 

Gene name
phhA
Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
ili  Idiomarina loihiensis GSL 199
Pathway
ili00360  Phenylalanine metabolism
ili00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ili00790  Folate biosynthesis
ili01100  Metabolic pathways
ili01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ili00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    K734_03635 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    K734_03635 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    K734_03635 (phhA)
Enzymes [BR:ili01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     K734_03635 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AGM35594
Position
complement(783145..783939)
Genome map
AA seq 264 aa AA seqDB search
MGKQSQYVSRQPDENGIIQWSDEENQVWKDLVERQLECIPGKACDEYMKGLELLDLPKDR
LPQMHEINNVLERETGWQVAAVPALIPFDEFFRLLANKQFPVATFIRTREEFDYLQEPDI
FHEIFGHCPLLTNPAFAHFTHQYGKLGYAATPKERVYLARLYWFTVEFGLLKTEEGIRIY
GGGILSSPAETEYAVNSDTPERKPLKALDALRTPYRIDIIQPIYYTIESVDELFKISDMD
IMSLVHEAMELGLFEPKFPPKDAA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaacaaagtcaatacgtatcaaggcaaccggatgaaaacggtattattcagtgg
agtgacgaagaaaatcaggtctggaaggatttggtcgaacgtcagttggaatgcataccg
ggtaaagcttgcgatgagtatatgaagggactggagttactcgacttgccgaaggatcgc
ttgccacaaatgcatgaaattaataatgtgctggagagagagacaggctggcaagttgca
gcagttccagcgttaattccatttgacgagttttttcgcctactggcaaacaagcagttt
ccggtagcaacctttattcgcacacgggaagagtttgattacttgcaggaacctgatatt
tttcacgaaatattcggacactgcccactattaaccaacccggcgtttgcgcattttact
caccaatacggtaaattgggttatgcagccacacccaaagaacgggtctatctggctcgc
ctgtactggtttaccgtagagttcgggttattgaaaaccgaagagggtatccgaatttat
ggtggcggtattttatcgtctccggctgaaacggaatacgccgttaacagcgatacgcca
gagcgcaaaccactgaaagcgttagatgcgctacgtacaccgtaccgaattgatattatt
caacctatctactacaccatagagagtgtggacgagctgtttaagatatccgatatggat
atcatgtcgctggttcatgaagctatggagctagggttgtttgaaccaaaatttccacca
aaagatgcagcttaa

DBGET integrated database retrieval system