KEGG   Idiomarina loihiensis GSL 199: K734_09660Help
Entry
K734_09660        CDS       T02681                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ili  Idiomarina loihiensis GSL 199
Pathway
ili03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ili00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    K734_09660 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ili03011]
    K734_09660 (rplV)
Ribosome [BR:ili03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    K734_09660 (rplV)
  Bacteria
    K734_09660 (rplV)
  Archaea
    K734_09660 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AGM36793
Position
complement(2049759..2050091)
Genome map
AA seq 110 aa AA seqDB search
MEAIAKHQFARVSAQKGRLVADQIRGLPVEKALDILAYSPKAAAGLIKKVLESAIANAEH
NEGADIDELKVSRVFLDEGPTMKRIKPRAKGRADRIFKRTSHITVVVSDS
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaattgctaaacaccaatttgcccgcgtttcagcgcagaagggccgtttggtc
gcagaccaaatccgtggacttccggtagaaaaagcactggatatcctggcatacagcccc
aaagcagctgctggcttaatcaagaaagttcttgagtcagcaatcgcgaacgcggaacat
aacgaaggtgcggatattgatgaacttaaagtgagccgagtctttttagacgaaggtcct
actatgaagcgcatcaagccacgggcgaaaggccgtgccgatcgtatctttaagcgcacc
agccacattactgtggtcgtgtcagatagctag

DBGET integrated database retrieval system