KEGG   Idiomarina loihiensis L2TR: IL0278Help
Entry
IL0278            CDS       T00218                                 

Definition
(GenBank) Fatty-acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
ilo01040  Biosynthesis of unsaturated fatty acids
ilo01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    IL0278
Enzymes [BR:ilo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     IL0278
Lipid biosynthesis proteins [BR:ilo01004]
 Desaturase
  First
   IL0278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase Apolipoprotein DUF5469 SecA_SW DUF349 Exonuc_VII_L Phage_Mu_Gam
Motif
Other DBs
NCBI-ProteinID: AAV81121
UniProt: Q5QUM9
Position
293049..294188
Genome map
AA seq 379 aa AA seqDB search
MQKISEKPPIIWLNTLVFSITFIVAIVGVPLYAYSVGIGAAFWWVMLGTACFAGLSITAG
YHRLWAHRTYDANPVIRFIFAIGGAVALQNSALHWSSDHREHHKHVDDNDKDPYSAKRGF
WYSHIGWMIREYQASRYTDYDNVKDLQKDPIVMWQHKYYLPLTLFVNFGWPIAAGFMLGD
VWAGLLVIGVLRLVLNHHTTFFINSLAHIWGKQPYTDKNTARDNGVLAFLTFGEGYHNYH
HIFAADYRNGIRWWQFDPTKWLIVASKWLGLAKNLKRSSPYQVERAKLQMQLKRAQLKAQ
AAPESLFERAQEHYDQMGQQLKAYYQARKKLLDTKAKALKEHVHHDIDALKRQVDEMKAS
LEMQKRSWKALLNQIQQHA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagatttctgaaaagccccccattatctggttaaacaccctggtgttctctatt
acctttattgtcgccattgttggtgtacctttatacgcatacagcgttggcattggtgcc
gcgttttggtgggttatgttgggcacggcgtgtttcgccggcttatctattactgcgggc
tatcatcgcctgtgggcgcatcgtacatacgatgcaaacccggtaattcgttttattttt
gccattggcggtgcggttgcgctgcagaacagtgcgcttcactggtcttctgaccaccgt
gagcaccacaagcacgttgatgacaacgacaaagacccgtattcagctaagcgaggcttc
tggtactcgcatattggctggatgatccgtgaatatcaggcgagccgttatactgactac
gataacgttaaagacctgcagaaagacccaattgttatgtggcagcacaagtattacttg
ccgctaactctgtttgtgaactttggctggccaattgccgccggtttcatgctgggcgac
gtgtgggcaggattgttggttattggcgtgttgcgcctggtgctaaaccaccacaccact
ttctttattaactcgctggcgcatatttggggtaaacagccttataccgacaaaaacact
gcgcgcgacaatggcgtgctggcgtttctgacgtttggcgagggttaccataattaccac
cacatttttgccgcggattatcgtaacggtattcgctggtggcagttcgacccaactaaa
tggctgatcgtagccagtaaatggctgggtctggcgaaaaacttaaagcgcagctcgccg
tatcaggtcgagcgggcgaaactgcaaatgcagttaaaacgagctcagctgaaagctcag
gcagcgccggaatctttgtttgaaagggctcaggaacattatgaccagatgggccagcag
ttgaaggcatattatcaggctcgtaaaaagcttctggatactaaagctaaagccttgaaa
gaacatgtgcatcacgatattgatgcgttgaagcgtcaggttgatgaaatgaaggcttcg
ctggaaatgcaaaaacgctcctggaaagcgctattaaatcaaattcagcagcacgcgtaa

DBGET integrated database retrieval system