KEGG   Idiomarina loihiensis L2TR: IL0872Help
Entry
IL0872            CDS       T00218                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
ilo00071  Fatty acid degradation
ilo00072  Synthesis and degradation of ketone bodies
ilo00280  Valine, leucine and isoleucine degradation
ilo00310  Lysine degradation
ilo00362  Benzoate degradation
ilo00380  Tryptophan metabolism
ilo00620  Pyruvate metabolism
ilo00630  Glyoxylate and dicarboxylate metabolism
ilo00640  Propanoate metabolism
ilo00650  Butanoate metabolism
ilo00900  Terpenoid backbone biosynthesis
ilo01100  Metabolic pathways
ilo01110  Biosynthesis of secondary metabolites
ilo01120  Microbial metabolism in diverse environments
ilo01130  Biosynthesis of antibiotics
ilo01200  Carbon metabolism
ilo01212  Fatty acid metabolism
ilo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ilo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    IL0872
   00630 Glyoxylate and dicarboxylate metabolism
    IL0872
   00640 Propanoate metabolism
    IL0872
   00650 Butanoate metabolism
    IL0872
  09103 Lipid metabolism
   00071 Fatty acid degradation
    IL0872
   00072 Synthesis and degradation of ketone bodies
    IL0872
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IL0872
   00310 Lysine degradation
    IL0872
   00380 Tryptophan metabolism
    IL0872
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IL0872
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IL0872
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    IL0872
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ilo04147]
    IL0872
Enzymes [BR:ilo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     IL0872
Exosome [BR:ilo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IL0872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AAV81712
UniProt: Q5QW30
Position
complement(929296..930477)
Genome map
AA seq 393 aa AA seqDB search
MSSDSIVIVAANRTPMGGFQGSLSEVTAPNLGATAIKAALNNSGLAADDISEVIMGNVLP
AGLGQAPARQAMLHADLPRSTGATTINKVCGSGLKAAMMAHDLIKAGSADVVLAGGMESM
SNAPYMLPKGRSGYRMGHGQVLDHMMLDGLEDAYEHKAMGCYAQDTADEYGLGREAMDEF
AIHSLTKAQAAIKDGFFKDEITPVTYSTRKGDVTVDTDEQPGKARLDKIPQLRAAFKKDG
TITAANSSSISDGAAALILMRESDAKAKGLQPLARVMGHTTHSQAPSEFTVAPIGAMNSL
LSKLDWTKDDVDLWEINEAFAMVTMLAIQQMKLDPAKVNVHGGACALGHPIGASGARLLV
TLLHALKQKGQKRGITSLCIGGGEAVALAVEMI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcgattcaatcgttatagtagcggccaaccgtacgccaatgggcggttttcag
ggcagcttaagtgaagttaccgcccccaatttgggcgcaaccgcgataaaagcagcgctg
aataacagcggtttagcagccgatgatatttcagaagtaatcatgggcaatgtgttacct
gccggtttaggtcaggcaccagcgcgtcaggcaatgctgcatgcggatctacctcgctca
acgggcgcgaccaccattaataaagtatgcggctccggattgaaagctgcaatgatggcg
cacgatttaattaaagcgggctcagcagacgtggtactggccggtggcatggaaagcatg
tcgaatgcaccttacatgctgccaaaaggccgcagcggttatcgtatggggcacggacaa
gtgctggatcatatgatgctggacggtttggaagacgcctacgagcataaagctatgggg
tgttacgcacaggacaccgctgacgaatacggtctgggtcgtgaagcaatggatgagttt
gccattcattcacttaccaaagctcaggctgctattaaagatggcttttttaaagacgaa
atcaccccagttacatattctactcgtaaaggcgacgtcactgtcgatactgacgagcaa
ccgggtaaagcgcgtctggacaaaattcctcagttgcgtgcggcattcaaaaaagacggc
accattactgcggctaattccagttctatttctgatggcgcagcagcacttattttaatg
cgtgagagcgatgcaaaggccaaaggcctgcagccgctggcgcgagttatgggtcatact
acgcattctcaggcgccgtctgaatttaccgttgccccaattggtgcaatgaattctttg
ctgagtaagctggactggactaaagacgacgtcgatttatgggaaattaatgaagccttt
gccatggttaccatgctggctattcagcaaatgaaactggatccggctaaagtgaatgtg
catggcggagcctgtgctttagggcatcctattggcgcaagtggtgcgcggttattggtt
actttgctgcatgcactgaaacaaaaaggccagaaacggggtatcacctcactgtgtatt
ggtggtggtgaagccgttgctctggccgtagaaatgatctaa

DBGET integrated database retrieval system