KEGG   Idiomarina loihiensis L2TR: IL1211Help
Entry
IL1211            CDS       T00218                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
ilo00010  Glycolysis / Gluconeogenesis
ilo00030  Pentose phosphate pathway
ilo00051  Fructose and mannose metabolism
ilo00052  Galactose metabolism
ilo00680  Methane metabolism
ilo01100  Metabolic pathways
ilo01110  Biosynthesis of secondary metabolites
ilo01120  Microbial metabolism in diverse environments
ilo01130  Biosynthesis of antibiotics
ilo01200  Carbon metabolism
ilo01230  Biosynthesis of amino acids
ilo03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IL1211 (pfkA)
   00030 Pentose phosphate pathway
    IL1211 (pfkA)
   00051 Fructose and mannose metabolism
    IL1211 (pfkA)
   00052 Galactose metabolism
    IL1211 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    IL1211 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    IL1211 (pfkA)
Enzymes [BR:ilo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     IL1211 (pfkA)
Protein phosphatases and associated proteins [BR:ilo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     IL1211 (pfkA)
Messenger RNA biogenesis [BR:ilo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     IL1211 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AAV82051
UniProt: Q5QTW4
Position
1300323..1301357
Genome map
AA seq 344 aa AA seqDB search
MSSVNTINRIAIITSGGDAPGMNAALRAVVLAAENYGIEVMGFRHGYEGLLTNDFVKLDR
EDVEHILQYSGTIIKSARSERFKSEEGGREAATNLDAHQIDAFIVIGGDGSFRGAEHLAN
FWKGPIIGIPGTIDNDLFGTDNTIGYDTAVETAMDALDKIRDTAEAMDRVFIVEVMGRNA
GYIGISSAMACGAERMILPELQKDKPLTVDALVKHIESVQRVRGDSSYVMVLCENQWPGG
AVRLAEQLEDRLNLPCRPCLLGHVQRGGRPTAMDRILGTRLGVHAVELVRQGKTAVMAGV
TANELSETPLIDTWTKRKKLSEELINIQQSLFNPIKKDRNKSTQ
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtgtcatctgttaacacaataaaccgcattgccattataaccagtggtggcgatgccccc
ggtatgaacgccgcactccgtgctgtggttctcgctgctgaaaactatggcatagaagtc
atgggatttcgtcatggctatgaaggcctgctgactaacgactttgtaaaacttgaccgc
gaagacgttgagcacattttacaatattccggcaccattattaaaagcgcccgcagcgag
cgttttaaaagtgaagaaggtggacgggaagccgcaacgaatttagacgcacaccaaatt
gacgcctttatcgttattggcggcgacggctcgttccgtggcgctgagcatctggctaat
ttctggaaaggtcctattataggcatacccggcaccatcgataatgatctctttggcacc
gataacactattggctatgacacagcagtagaaaccgccatggatgcgctggataaaatc
cgcgataccgccgaggccatggatcgtgtctttattgtcgaagttatggggcgcaacgcc
ggttatatcggtattagcagcgctatggcctgtggtgccgagcgaatgattctgccagag
ctgcaaaaggataaaccattaacggttgatgcgctggttaagcacattgaatcggtacag
cgtgttcgcggcgactcaagctacgtgatggtgttatgcgaaaaccaatggcccggtggt
gcagttcgacttgcggaacagttagaggatcgtcttaacttaccttgtcgtccctgttta
cttgggcacgttcagcgcggtggacgccctacggcaatggatcgtattttaggaacgcgg
ctgggtgtgcatgcggttgaactcgttcgccagggaaaaacagcggttatggccggtgtt
acagcgaatgagctcagcgaaacaccattaattgacacctggacaaaacgtaaaaagctc
agtgaagagctcatcaacattcaacaaagtctgtttaacccgatcaaaaaagatcgcaat
aaatcgactcagtaa

DBGET integrated database retrieval system