KEGG   Idiomarina loihiensis L2TR: IL1688Help
Entry
IL1688            CDS       T00218                                 

Gene name
accA
Definition
(GenBank) AcetylCoA carboxylase, carboxytransferase component, alpha subunit
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
ilo00061  Fatty acid biosynthesis
ilo00620  Pyruvate metabolism
ilo00640  Propanoate metabolism
ilo01100  Metabolic pathways
ilo01110  Biosynthesis of secondary metabolites
ilo01120  Microbial metabolism in diverse environments
ilo01130  Biosynthesis of antibiotics
ilo01200  Carbon metabolism
ilo01212  Fatty acid metabolism
Module
ilo_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    IL1688 (accA)
   00640 Propanoate metabolism
    IL1688 (accA)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    IL1688 (accA)
Enzymes [BR:ilo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     IL1688 (accA)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     IL1688 (accA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACCA Carboxyl_trans MdcE
Motif
Other DBs
NCBI-ProteinID: AAV82521
UniProt: Q5QZP1
Position
complement(1811695..1812651)
Genome map
AA seq 318 aa AA seqDB search
MSLNFLDFEQPIAELEAQIEELKSVGNRGQLDLNLEEEVQRLTTKSQELTEKIFSDLGAW
QVAQLARHPLRPYTLDYIRMIFTEFDEMAGDRSFANDEAIVGGIARLDGTPVMVIGQQKG
RETKEKIRRNFGMPKPEGYRKALRLMQTAERFKMPIVTFIDTPGAYPGIGAEERGQSEAI
ARNLKVMARLTVPIVCTVIGEGGSGGALAIGVGDRVNMLQYSTYSVISPEGCASILWKSA
SKAPLAAEAMGVTAERSKELGLVDSVIPEPLGGAHRHQEEMAVRLKRQLIADLGSLQGLS
HEELLDQRYRKLMSFGYC
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagccttaattttctggattttgaacaacctattgcggaacttgaagcgcaaatcgaa
gaactgaagtctgttggcaaccgcgggcaactggatcttaacttagaagaggaagtgcag
cgactgaccaccaagagtcaggaactgacagagaaaatcttttctgatttaggtgcgtgg
caggttgcacagctggcgcgtcatccgttgcgtccttacacgcttgactatattcgcatg
atattcaccgagtttgacgaaatggcgggtgatcgctcttttgctaatgacgaggcgatt
gttggcggtattgcgcgtttagacggcactccggttatggttataggccagcaaaaaggc
cgtgaaaccaaagagaagatccgtcgtaactttggtatgccaaagccggaaggttatcgt
aaggcgctacgcctgatgcaaaccgccgagcgttttaaaatgccaattgttaccttcatt
gatacacctggagcttacccgggaattggtgcggaagagcgcggtcagagtgaagccatt
gcacgtaacctgaaagttatggctcgtttaaccgttcctattgtttgtactgttattgga
gaaggtggttctggtggtgctctggctattggtgtcggtgaccgcgttaacatgctgcaa
tacagtacgtactcggttatttctccggaaggttgtgcttctattttgtggaaaagtgcc
agcaaagcgccattagcggcagaagctatgggcgtaaccgcagagcggagtaaagagctg
ggtctggttgattctgtgatacctgaacctttaggcggcgcgcaccgccatcaggaagaa
atggcggtacgccttaagcgtcagctgattgctgatttaggaagcttacagggcttaagc
catgaggaattgctggaccagcgttatcgtaaactcatgtcttttggttactgctaa

DBGET integrated database retrieval system