KEGG   Idiomarina loihiensis L2TR: IL1919Help
Entry
IL1919            CDS       T00218                                 

Gene name
rplV
Definition
(GenBank) Ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
ilo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ilo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    IL1919 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ilo03011]
    IL1919 (rplV)
Ribosome [BR:ilo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    IL1919 (rplV)
  Bacteria
    IL1919 (rplV)
  Archaea
    IL1919 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AAV82751
UniProt: Q5QXY2
Position
complement(2049644..2049976)
Genome map
AA seq 110 aa AA seqDB search
MEAIAKHQFARVSAQKGRLVADQIRGLPVEKALDILAYSPKAAAGLIKKVLESAIANAEH
NEGADIDELKVSRVFLDEGPTMKRIKPRAKGRADRIFKRTSHITVVVSDS
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaattgctaaacaccaatttgcccgcgtttcagcgcagaagggccgtttggtc
gcagaccaaatccgtggacttccggtagaaaaagcactggatatcctggcatacagcccc
aaagcagctgctggcttaatcaagaaagttcttgagtcagcaatcgcgaacgcggaacat
aacgaaggtgcggatattgatgaacttaaagtgagccgagtctttttagacgaaggtcct
actatgaagcgcatcaagccacgggcgaaaggccgtgccgatcgtatctttaagcgcacc
agccacattactgtggtcgtgtcagatagctag

DBGET integrated database retrieval system