KEGG   Idiomarina loihiensis L2TR: IL1949Help
Entry
IL1949            CDS       T00218                                 

Gene name
holC
Definition
(GenBank) DNA polymerase III chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
ilo00230  Purine metabolism
ilo00240  Pyrimidine metabolism
ilo01100  Metabolic pathways
ilo03030  DNA replication
ilo03430  Mismatch repair
ilo03440  Homologous recombination
Module
ilo_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    IL1949 (holC)
   00240 Pyrimidine metabolism
    IL1949 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    IL1949 (holC)
   03430 Mismatch repair
    IL1949 (holC)
   03440 Homologous recombination
    IL1949 (holC)
Enzymes [BR:ilo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     IL1949 (holC)
DNA replication proteins [BR:ilo03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     IL1949 (holC)
DNA repair and recombination proteins [BR:ilo03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     IL1949 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: AAV82781
UniProt: Q5QY16
Position
2074566..2075015
Genome map
AA seq 149 aa AA seqDB search
MSSATFFLMPDEAEDEQNRLICDKIAQLYRKHKKLRVWARNQQQAEALDELLWQQPSDAF
IPHNLHGEGPATGAPVEFCWPEADAVKNRPGYALFNLAEEIPVQAQQSQQLYDIVPADDN
GKKTARERYKHYRARGCQMQTEPLTSEQK
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcagccacctttttcttaatgccggacgaagctgaagatgagcaaaaccggctt
atctgcgataagatagcgcaactgtaccgaaagcataaaaagttgcgggtctgggcgcgt
aatcagcagcaggctgaagctttggacgaactcttgtggcaacaaccaagtgatgctttt
attccgcataacttacacggcgaaggcccggccactggtgctccggtagagttttgctgg
cctgaggcggatgcagtaaaaaaccgtccgggttatgcactgtttaacctggcggaagag
attccggtacaagcccagcagagccaacagctctatgacattgttccagccgatgacaat
ggcaaaaaaacagctcgcgagcgttacaaacattacagggcgcgcggttgccaaatgcaa
accgagcccctgacatccgaacagaagtaa

DBGET integrated database retrieval system