KEGG   Idiomarina loihiensis L2TR: IL2233Help
Entry
IL2233            CDS       T00218                                 

Gene name
apaG
Definition
(GenBank) Uncharacterized conserved protein
  KO
K06195  ApaG protein
Organism
ilo  Idiomarina loihiensis L2TR
Brite
KEGG Orthology (KO) [BR:ilo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    IL2233 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AAV83065
UniProt: Q5QVN6
Position
2387963..2388337
Genome map
AA seq 124 aa AA seqDB search
MTVSKIEIDVKTQYLAAQSNPDAGQYVFSYTITITNESSQLVQLLAREWRITDADNKITR
VAGDGVVGQQPKLAAGESFSYTSGTVLATPIGTMEGHYLMIDEQGSQFKAPIPSFRLAIP
NIIH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcagtaaaattgaaattgatgtaaaaacgcaatatttagcggcgcagtcaaac
cctgatgccggacaatatgtattttcttacaccataaccataaccaatgagtccagccag
ttagtgcagttgcttgcccgcgaatggcgcattaccgacgcagacaataaaattacccgg
gtagccggtgacggtgtagtcggacaacagcctaaactggctgccggtgaatcattcagt
tataccagcggtaccgttctggctacgcctataggcactatggaagggcattacctaatg
atagatgaacagggctcgcagtttaaagcacctattccttcgttccggctggccatccct
aatattattcattaa

DBGET integrated database retrieval system