KEGG   Idiomarina loihiensis L2TR: IL2245Help
Entry
IL2245            CDS       T00218                                 

Gene name
hemL
Definition
(GenBank) Glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
ilo00860  Porphyrin and chlorophyll metabolism
ilo01100  Metabolic pathways
ilo01110  Biosynthesis of secondary metabolites
ilo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ilo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    IL2245 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ilo01007]
    IL2245 (hemL)
Enzymes [BR:ilo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     IL2245 (hemL)
Amino acid related enzymes [BR:ilo01007]
 Aminotransferase (transaminase)
  Class III
   IL2245 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Ligase_CoA
Motif
Other DBs
NCBI-ProteinID: AAV83077
UniProt: Q5QVP9
Position
2401007..2402290
Genome map
AA seq 427 aa AA seqDB search
MSRSEELYTKAQISIPGGVNSPVRAFNGVGGSPIFFESAEGAYMIDADGKRYIDYVGSWG
PMILGHNHPAVLEATLQAAKRGLSFGTPTEVEITMAETIRKIVPSIEKVRMVNSGTEATM
TAIRLARGYTGRDKILKFEGNYHGHADSLLVKAGSGALTLGVPNSPGIPEDFAKHTLTAT
YNDIESVKQIFAEMGDEIACIIVEPVAGNMNCIPPVDGFLEGLRSICDDHGSVLIFDEVM
TGFRVAPGGAQDRYKIKPDLTTLGKVIGGGMPVGAFGGKKEVMDYIAPVGPVYQAGTLSG
NPVAMAAGLAALQQLSTPGLYDQLYQRVDTLLDGLQERADRAGVPMTTNRAGSMFGFFFT
EEPEVTTYAQATQCNMEHFKTFYHAMLEQGVYLAPSAFEGGFMSAAHSEEDIQNTLNAAE
KAFAKLV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgctcagaagaactatacactaaagcacaaatcagtatccctggcggcgttaac
tcgccggttcgggcttttaacggcgttggtggcagccccatcttctttgagagtgctgaa
ggcgcttatatgattgatgcagacggcaaacgttatatcgattacgtcggctcatggggc
ccaatgattttggggcataaccacccggcagtgttagaagccaccctgcaggccgccaag
cgaggcctgagcttcggcacaccgacggaagttgaaatcaccatggcggagactattcgc
aaaatagtcccttctattgaaaaagtgcgtatggtgaattccggtactgaagccactatg
actgccattcgtctggcacgcggctatactggtcgggataaaattctgaagtttgaaggt
aactaccacggtcatgccgactccttgctggttaaagctggttcaggtgctttgactctg
ggcgttcctaactctcccggcattccggaagactttgcgaaacataccttaaccgcaact
tacaacgatattgaatcggtgaaacagattttcgctgaaatgggcgacgagattgcctgc
attattgttgagccggtagccggtaacatgaactgtattccaccggttgacggttttctg
gaaggcttacgcagcatttgtgacgaccacggttcagttctgatttttgacgaagttatg
accggtttccgtgtagctccgggcggcgctcaggatcgctataagattaaaccagacctc
acgactttaggtaaagtgattggcggtggcatgccggttggtgcctttggcggcaaaaag
gaagtgatggactacattgcgccggtgggccccgtgtatcaggcaggaaccttatctggt
aacccagtcgccatggcagcaggcttggcagcgttacagcagttatccaccccagggctt
tacgaccagctttaccaacgcgttgacacactgcttgacggtttacaggagcgtgctgac
cgggctggcgtgccaatgacaacaaatcgcgccggttctatgtttggtttcttttttact
gaagagcccgaagtaaccacttacgctcaggccacacagtgtaatatggagcactttaag
acgttttatcacgccatgttagagcaaggcgtgtatcttgcgccatcggcctttgaaggc
ggctttatgtcggcagcgcacagcgaagaagacattcaaaacactctgaatgccgctgaa
aaagcctttgctaagttagtctaa

DBGET integrated database retrieval system