KEGG   Ipomoea nil (Japanese morning glory): 109146488Help
Entry
109146488         CDS       T04663                                 

Definition
(RefSeq) tripeptidyl-peptidase 2
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
ini  Ipomoea nil (Japanese morning glory)
Brite
KEGG Orthology (KO) [BR:ini00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ini01002]
    109146488
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ini03110]
    109146488
Enzymes [BR:ini01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     109146488
Peptidases and inhibitors [BR:ini01002]
 Serine peptidases
  Family S8: subtilisin family
   109146488
Chaperones and folding catalysts [BR:ini03110]
 Intramolecular chaperones
  Subtilisin family
   109146488
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII CcdA
Motif
Other DBs
NCBI-GeneID: 109146488
NCBI-ProteinID: XP_019149677
Position
Un
AA seq 1345 aa AA seqDB search
MQSLLQYKAFVIPPLSQSPFFISPPGRRLIITPKKRSGSSTLERGLSRSRAMTCSSIVTS
GDDNGALRNFRLNESTFLASQMPKKEIAADRFIEAHPHYDGRGVVIAIFDSGVDPAAAGL
QVTSDGKPKVLDVLDCTGSGDVDTSTVVKADADGCIQGASGASLIVNSSWNNPSGEWHVG
CKLVFELFTDDLTSRVKKERKKKWDEKNQEAITEAVKQLDEFDKKHAKCEDANLKRVRED
LQNKVDLLRKQTDSYDDKGPVIDAVVWHDGEVWRAALDTQSLQDEPECGKLADFLPLTNY
RIERKHGVFSKLDACTFVLNVYNEGNILSIVTDSSPHATHVAGIAAAYHPKEPLLNGIAP
GAQLISCKIGDSRLGSMETGTGLTRAVIAAVEHKCDLINMSYGEATLLPDYGRFVDLVDE
VVNKHRIIFVSSAGNNGPALTTVGAPGGTTSSIIGIGAYVSPAMAAATHLLVEPPSEGLE
YTWSSRGPTADGDVGVSISAAGGAVAPVPTWTLQRRKLMNGTSMSSPSACGGVALLISAM
KAEGIPVSPYTVRKALENTASPVGTLPEDKLTAGEGLMQVDKAYEYVQKSQHFPCVRYQV
NINQAGKSSKPSPTSRGIYLREINSCNQSTEWTVEVQPKFHEDASNLEELVPFEECIQLH
STGHTVVRSPEYLLLTHNGRSFNVVVDPTSLGDGLHYYEVYGVDCKAPWRGPLFRIPVTI
TKPKAVKNRPPLISFQGMAFSPGHVERRFIEVPVGATWVEATMRASGFDTARRFFIDTVQ
LFPLQRPSKWESVATFSSPSAKSFAFPVEGGCTMELAVAQFWSSGIGSHETTIVDFEIGF
HGIDANKEEVVLDGSEAPIRIDAEAPLSTETLAPTAVLNKVRTPYRPIDAKVHALSADRD
KLPSGKQILALILTYKFKLEDSAEVKPQIPLLNNRIYDNKFESQFYMISDSNKRVYAMGD
VYPSSSKLPKGEYSLQLYLRHDNVQYLEKMKQLVLFIERTLEDKDSIRLSFYAQPDGPVT
GDSNFSSSVLIPGVKEAFYLGPPSKDKLPKNCSEGSVLLGTVSYGKLNEGKDSQKNPASY
QISYMVPPTKLNDDKEKSSLTSNQTISEKLDAEVRDAKIKVLAGLNQGTDEERSEWRKLS
ILLKSEYPKYTPLLAKILEGLLSQKNVEDKIQHYEEVTDAADEVVVSIDREELAKYFSLK
RDAEDDAAEKMKKKMETTRDQLVEALYQKGLALAEIESLKADSQPVTVSDVESDLFEKNF
KELKKWVDVNSSRYGKLSVLRERRLGRLGTALKVLIDMIQEDGDPPKRKLYELKLSLLKQ
MGWGHLVAYEKEWMLVRFPSSLPLF
NT seq 4038 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagcctcttacaatataaagcatttgttattcctcctctgtcccagtcaccattt
tttatttcccccccaggtcgaagactcattattacacccaaaaagcgcagcggtagctca
actctagagaggggactgagcagaagtagggccatgacttgttcctcgattgtaacttcc
ggcgacgacaacggagctctgcgcaatttcagactgaacgagtccactttccttgcttct
caaatgcctaagaaggaaatcgccgccgatcgcttcatcgaagctcaccctcactacgac
ggccgcggcgtcgtcatcgcaattttcgattctggagttgatccagctgcagctggttta
caggtgacatcggatgggaaaccaaaagttctggatgtgttagattgtactggtagtgga
gatgttgatacatccactgtagtgaaggctgatgctgatggttgcattcagggagcatct
ggagcttctttgattgtaaattcttcgtggaataatccatccggtgaatggcatgtgggt
tgcaaattggtatttgagctgttcactgatgatcttacttctcgtgtgaagaaagaaaga
aaaaaaaagtgggatgagaaaaatcaggaagcaatcacggaggctgtaaagcaacttgat
gagtttgataagaaacatgcaaaatgtgaggatgccaatttgaaaagggttcgtgaggac
ctccagaacaaagttgatcttctgcgcaagcaaactgatagctatgatgacaaggggcct
gttattgatgctgttgtatggcatgatggagaagtatggagggctgctcttgacacacag
agtcttcaggatgaacctgaatgtggaaagctcgctgatttccttcctctaacaaattat
agaattgaacggaagcatggagtatttagcaaattggatgcttgtacttttgttttaaac
gtgtacaatgaaggcaatattctcagtatcgtaacggatagttctccacatgctactcat
gttgctggtattgctgcagcttaccatccaaaggaacctttgctaaatggaattgcacct
ggagcacagttgatatcatgtaaaattggtgattctcgcttaggttcaatggaaactgga
acaggattgactcgggctgtgattgcagctgtggagcataagtgtgatctcatcaacatg
agttatggggaagccacattactcccggattatggtcgctttgttgatcttgttgatgag
gtggtcaacaagcaccgtataatatttgtaagcagtgcgggcaacaatgggccagcgttg
actaccgtgggtgcacctggtggtactacatcaagcattataggaattggtgcatatgta
tctcctgctatggctgctgcaactcacttgttggttgagccaccttctgaaggccttgag
tacacatggtctagtcggggaccaactgctgatggagatgttggtgtctctataagtgct
gctgggggagctgtggctcctgttcccacatggactcttcaaagacgcaagttgatgaat
ggaacatccatgtcctctccttctgcttgtggtggagttgctttacttataagtgctatg
aaggctgaaggaattcctgtgagcccgtacactgtgcggaaggctctagaaaatacagct
agtcctgtggggacgctgccagaagataaattaacggctggagaagggcttatgcaagtt
gacaaggcttatgaatatgttcagaagtcacaacacttcccttgtgtacggtatcaagtc
aatatcaatcaggctggaaaatcaagtaaaccttcccctacatcacgaggtatttacctc
agggagattaattcttgtaaccaatcaacagagtggacagttgaagttcaaccgaaattt
catgaagatgcaagtaatttagaggaactggttccttttgaagagtgtattcagttgcat
tccactggacacacagtcgttagatctccagagtacctcctcctcacccataatgggcgt
agcttcaatgttgttgttgaccctaccagtcttggtgatggtttgcattattatgaagta
tatggagtggactgcaaggccccatggcgcggtcctcttttcagaattccagttactata
acaaagccaaaagctgtgaaaaatcgcccccctttaatttcatttcaggggatggcattt
tcgccaggtcatgttgaacggaggtttattgaggtaccagttggtgctacttgggttgag
gctactatgagagcatcaggttttgatacagctagaagattcttcatcgacaccgttcag
ctctttcctttgcaaagaccaagcaaatgggaaagtgtggctacattttcttcaccttct
gctaaaagctttgccttcccagtggagggtggttgcacaatggaactagcagtagctcag
ttttggtctagtggaataggaagtcatgagaccaccattgttgattttgagattggattt
catggtatcgacgctaacaaagaggaagtggttcttgatggaagtgaagcgcctataaga
attgatgctgaagctcctctatcaactgagacccttgcccctactgcggtgcttaacaag
gttcgaactccatatcgtccaattgatgctaaagttcatgccctctcagcagatagggac
aaattaccatcagggaagcagatacttgcattaatactaacttacaaattcaaactggaa
gatagtgctgaagtcaagcctcagattccattacttaacaatcgcatttatgataataaa
ttcgagtctcagttttatatgatatcagattctaacaagcgtgtgtatgcaatgggtgat
gtttatccgagttcttcaaaacttcccaagggtgaatacagtttgcagctttatttgagg
catgataatgtgcagtacttagagaaaatgaaacagttggtgttgttcattgaaagaacc
ttggaggacaaggatagtattcgacttagcttttatgctcaacctgatggtccagtgacg
ggtgacagtaacttctcatcttctgttctgattcctggggtgaaggaagcgttttatttg
ggtcctccttcgaaggacaagctcccaaagaactgctctgaaggatcagtattgctaggg
acagtgtcctatggaaagcttaacgaggggaaagattcacaaaagaaccctgcatcgtat
caaatatcatatatggtgcctccaaccaagcttaatgatgacaaggagaaaagttcctta
actagcaaccagaccatatctgaaaagttagatgcagaggtccgtgatgctaaaataaag
gttcttgctggcttaaaccaaggcactgatgaggaacggtcagaatggagaaagttatca
atcttacttaagtcggaatacccaaaatacacccctttgcttgctaaaatattggaaggt
cttctttcacaaaaaaatgttgaagacaagatccaacactatgaagaggttactgatgca
gcagatgaggttgttgtaagcattgatagagaagagttagccaaatacttttccctcaaa
cgtgatgccgaagatgatgctgcagaaaaaatgaagaagaaaatggaaacaactcgcgac
cagttggtagaagcactctaccagaaaggattggctttggcagagattgaatcattgaag
gcagatagccaacctgtaacggtgtctgatgttgagtcagacttgtttgaaaagaacttc
aaagaactaaagaagtgggtagatgtcaactcatctagatatggaaaactttctgttttg
cgtgagagacgtcttggaagactaggaactgcattgaaggttttaattgacatgattcaa
gaagacggggaccctcctaagaggaagctttatgaactaaagctctcattgctcaagcaa
atgggttggggtcatctggtggcatatgagaaagaatggatgctcgtccgtttcccatca
agcctaccccttttttag

DBGET integrated database retrieval system