KEGG   Ipomoea nil (Japanese morning glory): 109149062Help
Entry
109149062         CDS       T04663                                 

Definition
(RefSeq) UDP-glucuronate 4-epimerase 3-like
  KO
K08679  UDP-glucuronate 4-epimerase [EC:5.1.3.6]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00520  Amino sugar and nucleotide sugar metabolism
ini01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    109149062
Enzymes [BR:ini01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.6  UDP-glucuronate 4-epimerase
     109149062
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD Polysacc_synt_2 NAD_binding_4 NmrA adh_short KR
Motif
Other DBs
NCBI-GeneID: 109149062
NCBI-ProteinID: XP_019152247
Position
Un
AA seq 431 aa AA seqDB search
MSQMKHIDSIPSTPGKFKYNRSRLHSSVAKLTFWSFVFVGLIYFFFFRSPSSYSSSSSSD
LSRRSLRTSSYSGPAWEERVRSSAKVRSSNGICVLLTGAAGFVGTHVSAALRRRGDGVLG
IDNFNDYYDPSLKRARQALLERTGVYIVEADINDVELLRKLFDIVQFTHVMHLAAQAGVR
YAMENPGSYVHSNIAGFVSLLEVCKGVNPQPAIVWASSSSVYGLNTKVPFSEEDRTDQPA
SLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFTKDILKGKAIPIF
EAPDHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAQLRVFNLGNKSPVPVSD
LVSILERLLKVKAKRKIMKLPRNGDVQYTHANISYAQREFGYEPTTNLQTGLKKFVRWYL
TYYADGKKSDQ
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagatgaagcacattgacagcattccatcaacccctgggaagttcaagtacaat
aggtctaggctccattcttccgttgccaagctcactttctggtcctttgtttttgtgggg
ttgatctattttttcttcttcagatcaccgtcttcttattcttcttcttcttcttcagat
ctctctaggaggtctctgaggaccagctcctacagcggcccagcctgggaggagagggtt
aggtcctccgcaaaggttaggtcaagtaatggcatctgtgttttgcttactggggctgct
ggcttcgttggcacccacgtctccgctgccctcaggagacgcggcgatggcgtcttgggc
attgataatttcaacgattactatgacccttcattgaaaagagcccggcaagcccttcta
gagcgcacaggggtgtacattgtggaagccgacattaacgatgtggagcttttgaggaag
cttttcgacattgttcagttcacccacgttatgcatttggccgctcaagctggggtgcga
tatgctatggaaaatccgggctcctatgttcatagcaacattgcaggatttgttagtctt
cttgaggtttgcaagggggttaatccccagccggctatagtctgggcatcttctagttct
gtttatgggttaaacactaaggtcccattctcagaggaggataggacagaccagcctgct
agtctctatgctgccactaagaaagccggggaggaaattgcccatacttataaccatatc
tatggcctttccttgactggattaaggtttttcactgtttatggaccctgggggagaccc
gacatggcttacttctttttcactaaggatatcttgaaagggaaggcgattcccatattc
gaggccccggatcatggaactgttgccagggatttcacctacattgatgacatagtgaag
gggtgtttgggggctttggatactgctgagaagagtactggtagtggtggcaagaagaag
gggcctgctcagttgcgggtgtttaatctcgggaataagtcccccgtgcccgtttctgat
cttgtcagcattcttgagaggctgctaaaggtgaaggccaagaggaaaataatgaagctt
ccaagaaacggggatgtgcagtatacacacgcgaatatcagctatgcacagagggagttc
gggtatgagcctactaccaatctgcagacaggtttaaagaaattcgttcgatggtacctt
acttactatgccgatggaaagaagagcgaccagtga

DBGET integrated database retrieval system