KEGG   Ipomoea nil (Japanese morning glory): 109149066Help
Entry
109149066         CDS       T04663                                 

Definition
(RefSeq) (DL)-glycerol-3-phosphatase 2
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
ini  Ipomoea nil (Japanese morning glory)
Brite
KEGG Orthology (KO) [BR:ini00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ini01009]
    109149066
Enzymes [BR:ini01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     109149066
Protein phosphatases and associated proteins [BR:ini01009]
 HAD phosphatases
  Other HAD phosphatases
   109149066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like Hydrolase_6 Isochorismatase
Motif
Other DBs
NCBI-GeneID: 109149066
NCBI-ProteinID: XP_019152254
Position
Un
AA seq 245 aa AA seqDB search
MTNPSGNSSSPSTQKPSITHIIFDMDGLLLDTEKFYTEVQEIILARYNKTFDWSLKAKMM
GKKAIEAATVFVEETGISDSLTAEDFLIEREAMLQNMFPTSELMPGASRFIRHLHAKGIP
ICVATGTHKRHFQLKTQQHGEIFSLMHHIVLGDDPEVKQGKPSPDIFLAAANRFEDGPVV
PHKVLVFEDAPSGVLAAKNAGMSVVMVPDPRLDSSYHGIADQVLSSLLDFNPSDWGLPPF
DDSSS
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatccaagcggcaatagttcctctccgtctacgcaaaaaccttcaatcactcac
atcatcttcgacatggacggccttcttcttgacactgaaaaattctacactgaagtccaa
gagattatactcgccagatacaataagacctttgattggtcacttaaggcaaaaatgatg
ggtaagaaggctatagaagctgctacggtctttgttgaggagacaggaattagtgattct
ctgacagctgaagattttcttattgaaagagaggctatgcttcagaatatgtttccaacc
agtgaactcatgccaggtgctagccgttttattcggcaccttcatgcaaaaggaatacca
atttgtgttgcaacaggcactcacaagcgtcattttcaattgaaaacacaacagcatggt
gaaattttttcgctgatgcatcatattgttcttggtgatgatccagaagtcaaacaaggg
aaaccttcacctgatatatttcttgcagcagccaatagatttgaggatgggccagttgtt
ccccacaaagttcttgtttttgaggatgctccttcaggtgttcttgcggctaagaatgct
ggcatgtcagtggttatggttcctgaccccaggttggatagctcttatcatggaattgct
gatcaggttcttagttctttattggattttaacccaagtgattggggactgcctccattt
gatgattcatctagctaa

DBGET integrated database retrieval system