KEGG   Ipomoea nil (Japanese morning glory): 109149270Help
Entry
109149270         CDS       T04663                                 

Definition
(RefSeq) pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ini00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109149270
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ini03041]
    109149270
Enzymes [BR:ini01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     109149270
Spliceosome [BR:ini03041]
 Complex C
  Other components
   Step II factors
    109149270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C AAA_22 DEAD AAA_30 AAA_19 T2SSE ABC_tran
Motif
Other DBs
NCBI-GeneID: 109149270
NCBI-ProteinID: XP_019152497
Position
Un
AA seq 715 aa AA seqDB search
MPSMANPVNSPHKHHQNQLNNRKGDFLRRQNIEKQRKSLPIATVEKRLVEEVHNNDTLII
VGETGSGKTTQLPQYLYHGGFCNDGRIIGVTQPRRVAAITVAKRVAEECGVELGQRVGYA
IRFEDVTSNLTKIKYMTDGLLLREALLDPYLSKYSVIIVDEAHERTVHTDVLLGLLKNVQ
KARSKNVCGGVNIDSVKPKNELPLEDKKEAHSDGIFKKFHAKKYTPLKLVIMSASLDARV
FSEYFGGARAVHVQGRQYPVDIFYTLKPETDYIDAALITIFQIHMEEGPGDILVFLTGQE
EIESAERLVHDHLRHLPEGNKKLLTFPIFSSLPSEKQMKVFMPAPAGYRKVILATNIAET
SVTIPGIKYVIDPGLVKARTYDADMGIDSLIVVKTSKAQALQRSGRAGREGPGKCYRLYP
ESEFEKLDDSTIPEIKRCNLSNVVLQLKALGIDNIVDFDFIDKPKRIALVKSMETLFLLG
AITENNELSDPTGHQMARLPLEPMHSKALILAGEFGCLEEMLISVAMLSVESIFYAPREK
LEESRNALKSFASPEGDHLTLLNVYRASIEFFEKSKITNGELKAEKNLRKWCKDNFINSR
SLRHARDIHSQIRRNVEQMGLRVSSCGDDMLIFRRCLAASFFLNAALKQPDGTYRVLSSG
STVQIHPSSVLFRAKPECIVFNELVQTNYTYVRNISRIDYLWLAELAPHFYALQD
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgccttcaatggcgaatcctgtgaattccccacacaaacatcatcagaatcaactaaat
aacaggaaaggtgacttcctcaggcggcaaaacattgaaaaacaaagaaaatctttacca
attgctaccgttgaaaagcggcttgttgaggaggtacacaacaatgacacattaataatt
gttggagagactggtagtggaaagacgacacagttacctcagtacctttatcatggagga
ttttgtaatgatggtcgaattattggggtcactcaacccagacgtgttgcagccataact
gtcgcaaaacgagttgctgaggaatgtggtgttgaattgggtcaaagggttggctatgcc
attagatttgaggatgtgacttccaacttaacaaagatcaagtacatgacagatggtttg
cttcttagggaagcattattggatccatacctctccaagtattctgttattattgttgat
gaggctcatgagagaacagtccacactgatgtgttacttggcttgttgaagaatgtacag
aaagcaaggtcaaaaaatgtgtgtggaggggtaaatattgatagtgtgaagcctaagaat
gagcttccgttggaggataaaaaggaggctcattctgatggtatcttcaaaaagtttcat
gccaaaaagtacaccccgctgaaattggtaatcatgtctgctagtctggatgcacgtgtc
ttttctgagtactttggtggtgctagagcagttcatgttcaggggcgacaatatcctgta
gatatattttacacccttaagcccgagacagattacatagatgcagcattgattactatt
tttcagatacatatggaggagggccctggtgatatactggtttttcttactggccaagaa
gagattgaatctgctgagaggcttgttcatgaccaccttcgacatttacctgaaggcaat
aagaagctcttaacatttcccatattttcatctcttccctctgagaaacaaatgaaagtt
tttatgcctgcaccagctggatatcgtaaggtaatactggcaactaatattgctgagaca
tcagtgacaatacctggaatcaagtatgtcattgatcctgggttggtgaaagcacgtacc
tatgatgctgatatgggaattgactcactgattgttgtgaaaacatccaaagcgcaagca
ctgcagaggagtggtcgtgctggccgtgaaggacctggcaaatgctaccgcctttatccc
gaaagtgagtttgagaaacttgatgattctacaattccagaaatcaagagatgcaatctc
tcaaatgttgtgttgcagctcaaggctctggggattgacaatattgttgattttgatttc
attgataaaccaaagaggattgcattggtcaaatcaatggagactctctttctgttgggt
gctataacagaaaataacgaactgtctgatcccactgggcatcaaatggccaggctgcca
ctagaacccatgcattcaaaggctctcattcttgctggtgagtttggctgcctggaagag
atgctaatatctgttgcaatgctctctgtggaatccatcttttatgctccccgtgaaaag
ttggaagagtctcggaatgcattgaaaagctttgccagtcctgaaggagatcatttgact
ttgcttaatgtatatcgtgcttctatcgaattctttgagaagagcaagatcacaaatggc
gaactgaaagctgaaaagaatctcagaaagtggtgcaaggataatttcatcaacagccgc
tccctaagacatgcacgtgacattcacagtcaaattcgcaggaacgttgaacagatgggt
cttcgggtctcttcctgtggagatgacatgcttatcttccgtcggtgcttggctgcttca
tttttccttaacgcagctctaaagcagcccgatggtacatacagggttttatcaagtggc
tcgacagttcaaatccacccgtcttctgtgctgtttcgagcaaaacccgagtgcatagta
tttaatgaattagtgcagactaactacacgtatgttcgcaacatctctagaatcgattat
ttgtggttagctgagctcgctcctcatttctatgccttgcaagactga

DBGET integrated database retrieval system