KEGG   Ipomoea nil (Japanese morning glory): 109149432
Entry
109149432         CDS       T04663                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00100  Steroid biosynthesis
ini01100  Metabolic pathways
ini01110  Biosynthesis of secondary metabolites
Module
ini_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    109149432
Enzymes [BR:ini01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     109149432
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 109149432
NCBI-ProteinID: XP_019152746
Position
Un
AA seq 369 aa
MDLNHLLDALLPSWTSAAMLLAFFVYLAIVGSLLPGKLVPGVTLSDGTRLHYRCNGLLSL
LLFVLLLGFGAWMGLVSPTAIADRGLELLSTTFIFSFLATLALYVFGCKSRDRSSSLKPH
VTRNLIHDWWFGIQLNPQFMGIDLKFFFVRAGMMGWLLINLSVLAKCIQEGNLNRSMVLY
QLFCALYIIDYFFYEEFITSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLSNKVELT
TAAVIANCLSFVIGYRVFRGANKQKHVFKKNPKAPIWGMPPKVVGGKLLASGYWGIARHC
NYLGDLLLALSFSLPCGISSAVPYFYPIYLLILLIWRERRDDARCAEKYKEVWEEYCKLV
PWRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctcaatcacctgctcgacgctctactcccttcgtggacttcggctgccatgcta
ctcgccttcttcgtttatctggcaattgttggatctcttcttcccggaaagctcgttccc
ggcgtcaccttgtccgatggcactcgcctccactatcgttgcaatggtttgttatcgctt
cttctgttcgttttgctacttgggtttggagcatggatgggtcttgtatcgcctactgca
atagcagacagagggcttgagcttttgtctacaacatttatattcagttttttggcaact
ttggcactctatgtttttggatgcaagtccagagatcgcagctcatctctgaagcctcat
gtaaccaggaacttaatccatgactggtggtttgggatacagcttaatcctcaattcatg
ggcattgatctcaaatttttctttgttagagctggaatgatgggatggttacttatcaat
ctttcagttcttgcaaaatgtattcaagaaggcaacttaaaccgatccatggttctctac
cagctattttgtgccctgtatattatcgactacttcttctatgaagaatttattacctcc
acatgggatataattgcggagagactggggttcatgctggtttttggcgatctagtgtgg
atccctttcaccttcagcattcagggttggtggcttttaagcaacaaagtggagctaaca
acagctgctgtaattgccaattgtctttctttcgtgattgggtatcgtgtatttagagga
gcaaacaagcagaagcatgtcttcaaaaagaacccgaaagctccaatatgggggatgcct
ccaaaagttgttggggggaaattgctggcttctggctattggggaattgcacggcactgt
aattacctaggggatttgttacttgccctctccttcagtttaccgtgtggaataagctct
gcagttccatacttctatcccatatatcttcttattttgctaatatggagggagagaagg
gatgatgcccggtgtgctgagaagtataaagaagtttgggaagaatactgtaagcttgtc
ccgtggaggatattgccatatgtttattaa

DBGET integrated database retrieval system