KEGG   Ipomoea nil (Japanese morning glory): 109149773Help
Entry
109149773         CDS       T04663                                 

Definition
(RefSeq) putative dihydroflavonol 4-reductase
  KO
K15891  NAD+-dependent farnesol dehydrogenase [EC:1.1.1.354]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00900  Terpenoid backbone biosynthesis
ini00909  Sesquiterpenoid and triterpenoid biosynthesis
ini01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    109149773
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    109149773
Enzymes [BR:ini01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.354  farnesol dehydrogenase (NAD+)
     109149773
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_4 GDP_Man_Dehyd NAD_binding_10 NmrA Polysacc_synt_2 RmlD_sub_bind adh_short BCMA-Tall_bind
Motif
Other DBs
NCBI-GeneID: 109149773
NCBI-ProteinID: XP_019153295
Position
Un
AA seq 374 aa AA seqDB search
MGKKLLVTGASGYLGGRLCHALLNNGHHVRAFVRRTSDLSSLPPPTDAGSSGAGALEFAF
GDVAYYESLLEACSGCHVIFHAAALVEPWLPDPSRFMTVNVGGLKNVLQACKESGTVEKI
IYTSSFFALGSTDGNIADESQTHPEKFFCTEYEKSKVMADRMALEAAAEGVPIIPVYPGV
VYGPGKLTAGNVFARLIIERFSWRLPGYIGQGKEKFSFSHVDDVVNGHISAMDKGRLGER
YLLTGENASFKDVFDLAAEITLTKKPRFGIPLATIEVYAWISVFFFRITGKLPLISPPTV
QVLRHQWAYSCEKAKAELDYNPRSLKEGLTEVLLWLKNSGLIQYPGAEPEAEPGADPGAE
PDDEGDQVPLLKSE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaaattattggtgacaggcgcttccggttacttaggcgggcgtctctgtcac
gctcttctcaataacggccaccacgtcagggcgttcgtccgccgaactagcgacctctcg
tccctacctccgcccacagacgccggaagtagtggtgccggagctttggaattcgcgttc
ggagatgtcgcctactacgagtcgctcctggaagcctgctccggttgccatgtcatcttc
cacgctgcagcgctagttgagccttggcttccagatccatctagattcatgaccgttaat
gttggaggattgaaaaatgtcttacaagcatgtaaagaatcagggacagtagagaaaatc
atatatacatcgtcgtttttcgcgttaggatcaactgatggaaatattgcagatgaatct
caaactcatcctgaaaaattcttctgtacggagtatgagaaatcaaaggtcatggctgat
aggatggcattagaagctgcagctgagggagtgccgataatccctgtttatccaggagta
gtttacggtccaggaaagctcacggctggaaatgtgtttgctcgtttgataatagagaga
tttagttggcgcttacctggttacataggccaaggaaaagaaaagttttcgttcagtcat
gttgatgatgttgtgaatgggcacatttcagccatggataaaggtcgtctcggtgaaaga
tatcttcttacaggtgaaaatgcatccttcaaagatgtttttgacttggctgctgaaatc
actcttacaaagaagcctcgttttggtatcccattagcgactattgaagtttatgcttgg
atatcagtttttttcttcagaataactgggaagcttcctctaatcagcccaccaacagtc
caggttctgagacatcagtgggcttattcctgtgagaaggccaaggcagagttggattac
aaccccagaagcttaaaagaaggtttgactgaggtactcctttggttgaagaactccgga
ttgattcagtacccaggggcggagccagaggcagagccaggggcggacccaggggcagag
ccagatgatgagggggaccaagtaccattattaaagagtgaataa

DBGET integrated database retrieval system