KEGG   Ipomoea nil (Japanese morning glory): 109154998Help
Entry
109154998         CDS       T04663                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00010  Glycolysis / Gluconeogenesis
ini00562  Inositol phosphate metabolism
ini01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109154998
   00562 Inositol phosphate metabolism
    109154998
Enzymes [BR:ini01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     109154998
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     109154998
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 109154998
NCBI-ProteinID: XP_019158283
Position
Un
AA seq 496 aa AA seqDB search
MKKAVEVAVLFVIFLSEFTLYSSAEGVFDVRKHLCTVSRYGIVKDILSEESIIAPEIPDQ
CTPIHINLLARHGTRAPTKKKIMELDALANRLEVLLEDGKEEMKSLEKVPAWLHGWKSPW
KGKRTGGQLIAEGEDELYNLGIRIRQLFPDLFNEEYHPDVYTIKASQIPRASASAVAFGM
GLFSGRGKLGPGRNQAFAVISESRASDRILRFHDCCRSYKGFRKSQHPTVDKLKEPVLNE
ITQRLMKKYGLNFTRQDISSLWFLCKQEASLLNITDQACSLFSPSEVSLLEWTDDLELFI
VKGYGNSLNYRMGVPLLEDVLQSMEQAIKAKEEGYAPGSYEKARLRFAHAETLLPFSCLI
GLFLEESEFERIQREEALPLPPKPPQKRNWRGSVVTPFGGNNMLVLYSCPTKESSKYYVH
VLHNEHPIPMAGCNGSAFCPFEIFKNRIAAPHLKHDYNTLCNVNPSASTSVWSRAFGWLF
SLRNTAEPSSKFVTDQ
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggccgtggaagtcgcagttttatttgtaatttttctcagtgaatttacccta
tattcaagcgctgaaggagttttcgatgttcggaaacatctctgtactgtatctaggtat
ggtattgtgaaagatatactatcagaagaatcgattatagctccggagattcccgatcaa
tgtaccccaatacacataaacctattggcaaggcatggcactcgtgctccaacaaagaaa
aagataatggagttagatgccttagccaaccgcttagaagtccttctggaagatggaaaa
gaagaaatgaaatcattggagaaagttcctgcttggctgcatgggtggaagtctccatgg
aagggaaagcgcacaggtgggcagctgattgctgaaggagaagatgaactatataatctt
gggataagaatcagacaactttttccagacctctttaatgaggaataccatccggatgtt
tatacaatcaaagcttctcagattcctcgggcatcagctagtgctgtggcatttggcatg
ggcctgtttagtggaagagggaagcttgggccaggcaggaatcaagcctttgcagttatt
agtgaaagccgtgcaagtgatagaattctgagatttcatgattgttgtcgaagctacaag
ggattcagaaagagtcaacaccctactgttgacaagcttaaggagcctgtcttgaatgag
atcactcagcgcttaatgaagaaatatgggcttaattttactaggcaagatatatcttct
ttatggtttctctgtaaacaggaagcatccttacttaacataactgatcaagcttgcagt
ctattcagtccgtcagaggtttctttgttggagtggactgatgacttggagttgttcata
gtaaaaggctatggtaattcattgaactacagaatgggagtgccattgcttgaagatgtg
cttcaatctatggagcaggcaatcaaggctaaagaagagggatatgctcctggaagttac
gaaaaggcaagactacgttttgctcatgcagaaaccctgcttcccttttcatgtttgatt
gggctatttcttgaagaatctgaatttgaacgaattcaaagagaagaagcattgccactc
cctcctaagcctcctcaaaagagaaactggcgaggcagtgtagtgacaccttttggtgga
aataacatgctagtactctatagctgccccacaaaggagtcaagcaagtattatgtgcat
gtgctgcacaatgaacatccaattccaatggcgggttgcaatggatcagcattttgccca
tttgaaatatttaagaaccgaatagctgctcctcacttgaaacatgactacaacaccctt
tgcaatgtaaacccgagtgcttcaacaagtgtttggtcaagagcgtttggatggcttttc
tcactaaggaacactgccgaaccatcctcaaagtttgtcactgaccagtag

DBGET integrated database retrieval system