KEGG   Ipomoea nil (Japanese morning glory): 109155303Help
Entry
109155303         CDS       T04663                                 

Definition
(RefSeq) heat shock 70 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini03040  Spliceosome
ini04141  Protein processing in endoplasmic reticulum
ini04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ini00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109155303
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109155303
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109155303
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ini01009]
    109155303
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ini03041]
    109155303
   03009 Ribosome biogenesis [BR:ini03009]
    109155303
   03110 Chaperones and folding catalysts [BR:ini03110]
    109155303
   04131 Membrane trafficking [BR:ini04131]
    109155303
   03051 Proteasome [BR:ini03051]
    109155303
   03029 Mitochondrial biogenesis [BR:ini03029]
    109155303
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ini04147]
    109155303
Protein phosphatases and associated proteins [BR:ini01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     109155303
Spliceosome [BR:ini03041]
 Complex B
  Other components
   Prp19 complex
    109155303
 Complex C
   Prp19-CDC5 complex
    109155303
Ribosome biogenesis [BR:ini03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    109155303
Chaperones and folding catalysts [BR:ini03110]
 Heat shock proteins
  HSP70 / DNAK
   109155303
Membrane trafficking [BR:ini04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    109155303
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    109155303
Proteasome [BR:ini03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    109155303
Mitochondrial biogenesis [BR:ini03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    109155303
Exosome [BR:ini04147]
 Exosomal proteins
  Proteins found in most exosomes
   109155303
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR Radial_spoke_3 Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 109155303
NCBI-ProteinID: XP_019158532
Position
Un
AA seq 650 aa AA seqDB search
MAKSEGKAIGIDLGTTYSCVGVWQNDRVEIIPNDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPQNTVFDAKRLIGRRFSDPSVQADMKHWPFKVVPGAGDKPMIVVQYKGEEKMFAPE
EISSMVLTKMKEVAEAFLGQTVKNSVITVPAYFNDSQRQATKDAGAISGMNVMRIINEPT
AAAIAYGLDKKGSRTGEKNVLIFDLGGGTFDVSILTIEEGIFEVKATAGDTHLGGEDFDN
RLVNHFVQEFKRKHKKDISGNARALRRLRTGCERAKRTLSSTTQTTIEIDSLYEGIDFYA
TITRARFEELNMDLFRKCMEPVEKCLRDAKIDKSQIHDVVLVGGSTRIPKVQQLLQDFFN
GKELCKSINPDEAVAYGAAVQAAILGGESDQKVQDLLLLDVTPLSLGIETAGGVMTTLIP
RNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERPMTKDNNLLGKFELKGIPPAPRGVPQIN
VCFDIDANGILNVSAEDKTAGVKNKITITNDKGRLSKEEIERLVQEAERYKAEDEQIKKK
VEAKNALENYAYNMKNTVKDDKLAGKLDPSDKQKIEKAVDETIEWLDRNQLAEVDEFEDR
LKDLENLCNPIISRLYQGGGGDVPMGGAGGGYGTADSAGTGQGPKIEEVD
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagagcgaaggaaaggcaattggcattgatctcggcacgacttacagttgtgtc
ggggtatggcagaacgacagagtagagatcatccccaatgatcaaggcaacaggacaacg
ccgtcctatgttgccttcaccgacaccgagaggctcatcggcgacgctgcaaagaatcag
gtggccatgaacccgcagaacaccgtgtttgacgcgaaacgcctcatcgggcggcgtttc
tccgacccttcggtgcaggcggacatgaagcactggccgttcaaggttgttcccggcgcc
ggcgacaagccaatgattgtggttcagtacaagggagaggagaagatgtttgctccagag
gagatttcttccatggttttgacgaagatgaaggaagtcgcagaggctttcttggggcag
acagtcaagaactctgtgattactgtccctgcctatttcaatgattcccagaggcaggct
accaaggatgcaggggcaatttcaggcatgaatgttatgaggatcatcaacgaacccacc
gccgctgcaattgcttatggtttggacaagaaaggttccagaaccggcgaaaagaatgtc
ttgatctttgatctcggcggcgggactttcgacgtgtctatactgactatcgaagaaggg
atcttcgaggtgaaagccaccgccggcgacacccacctgggcggcgaagatttcgacaac
aggctggtgaatcacttcgtgcaggaattcaagaggaagcacaagaaagatatcagtgga
aacgccagggctttaaggagactcagaaccggctgcgagagggcaaagagaactctgtct
tccaccactcagacaacaatagagatagattctttatatgaaggcattgacttctacgcc
accattacaagggcgaggtttgaagagctgaacatggatttgttcaggaaatgtatggag
ccagtggagaaatgcctgagggatgccaagattgataaatcccagattcatgatgtggtt
ctagttggtgggtctacaaggattcccaaagtccagcaacttctacaagacttcttcaat
ggcaaagagctctgcaagagcatcaacccagatgaagctgtggcttatggtgcagcagtc
caggctgcaattctgggaggtgaaagtgaccagaaagttcaagatttgctgcttcttgat
gtcacccctctcagccttggaattgagactgcaggtggtgtcatgacaaccttaattcct
aggaacaccaccattcccaccaagaaggagcaaatcttctccacttattcagacaatcag
cctggagtgttaatccaagtatacgaaggagagaggccaatgaccaaagataacaacctg
ctgggcaagtttgaactgaagggcattccaccagctccaagaggggttccacagatcaat
gtctgcttcgatatcgacgcaaatggcatactgaatgtgtctgcagaggacaagactgca
ggtgtgaagaacaagatcaccatcaccaatgacaagggaaggctaagcaaggaggagatt
gagagactggtccaagaggcagagagatacaaagctgaggatgagcagatcaagaagaag
gtggaagccaagaacgcattggagaactacgcatacaacatgaagaacaccgtgaaagat
gacaagcttgctgggaaactggacccatcagacaagcagaagatcgagaaggcggtggac
gagacaattgagtggctggacagaaatcagttggctgaagttgatgaatttgaagacaga
ttgaaggatttggagaacttgtgcaacccaatcatctccaggttgtatcaaggtggcgga
ggagatgtgccaatgggtggtgctggtggtggttatggcactgctgactctgctggcact
ggccaggggccaaaaattgaggaagttgattaa

DBGET integrated database retrieval system