KEGG   Ipomoea nil (Japanese morning glory): 109158538Help
Entry
109158538         CDS       T04663                                 

Definition
(RefSeq) glucomannan 4-beta-mannosyltransferase 2-like
  KO
K13680  beta-mannan synthase [EC:2.4.1.32]
Organism
ini  Ipomoea nil (Japanese morning glory)
Brite
KEGG Orthology (KO) [BR:ini00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ini01003]
    109158538
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ini02000]
    109158538
Enzymes [BR:ini01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.32  glucomannan 4-beta-mannosyltransferase
     109158538
Glycosyltransferases [BR:ini01003]
 Polysaccharide
  Structural polysaccharide
   109158538
Transporters [BR:ini02000]
 Other Transporters
  Others
   109158538
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_trans_2_3 Glyco_tranf_2_3 Glycos_transf_2 Glyco_transf_21
Motif
Other DBs
NCBI-GeneID: 109158538
NCBI-ProteinID: XP_019161997
Position
Un
AA seq 536 aa AA seqDB search
MAEVSGNIVAASMPETLRGPAADIAAQMGLMWELIKAPLIVPLLRLSVYVCLAMSLMLFF
ERLYMGIVIILVKIFFKKPDKRYKWEAMRDDLESGNASYPMVLIQIPMFNEKEVYKISIG
AACNLSWPSDRIVIQVLDDSTDLVIKDMIEKECIRWASKGVNIRYQIRETRGGYKAGALK
DGLKHDYVKECEYVAIFDADFRPEPDFLRRAIPFLVHNPNIALVQARWRFVNSDECLLTR
MQEMSLDYHFTVEQEVGSSTHAFFGFNGTGGVWRIGAINEAGGWKDRTTVEDMDLAVRAS
LKGWKFVYLGDLQVKSELPSTFKAFRFQQHRWSCGPANLFRKMVMEIVRNKRVNVWKKFY
VIYSFFFVRKIIAHMVTFFFYCVVLPLTILVPEVEVPKWGAIYIPCIITTLNSVGTPRSI
HLLFYWILFENVMSFHRTKATFIGLLEFRRANEWVVTEKLGDALKNKSTAKPVARKTKSF
FGDRILPQELGFAVFLFFCGCYDFLYGKNQYFIYLFLQVITFTIAGFGYIGTIVPS
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtttccggcaacattgtggcggcatcgatgccggagacgctccgggggccg
gcagccgacatagcggcgcagatggggctgatgtgggaactcatcaaagcgcccctcatt
gtccctctgttaaggttatccgtctatgtctgcctcgccatgtcgcttatgttgttcttc
gagcggctttacatggggattgtgattattctggttaagattttctttaagaaaccggat
aaacggtacaaatgggaggcaatgcgcgacgatttggagtccggcaatgcctcgtaccct
atggtcctcatccaaatccccatgttcaacgagaaagaggtttacaagatctccattgga
gctgcatgtaacctctcctggccgtccgatcgaattgtgattcaagtccttgatgattcc
actgatcttgtcattaaggatatgattgagaaagaatgcataagatgggcgagcaagggc
gtgaacattaggtaccaaattcgggagactagaggtggatacaaggctggagctctaaag
gatgggttaaaacacgattatgttaaagaatgtgaatacgtggcaattttcgacgccgat
tttcgccccgagcccgattttctccgccgggcaatcccgttcttggttcacaatcccaac
attgccctcgttcaagctcgttggcgtttcgtgaattctgatgagtgtttgctgacaaga
atgcaagagatgtcattggactaccattttacagtggagcaggaagtgggttcatcaact
catgcattctttggattcaatgggactggtggtgtgtggaggattggtgccatcaatgag
gctggtgggtggaaagacagaacaaccgttgaggatatggatcttgctgtccgagctagt
cttaagggctggaaattcgtctacctcggagacctccaggttaaaagcgagctacctagt
actttcaaggccttccgtttccagcaacatcgctggtcttgcggtcctgccaatttgttc
agaaaaatggtcatggaaatcgtcagaaacaagagagtgaatgtatggaaaaagttctac
gtgatctacagcttcttcttcgttaggaaaatcatagctcacatggtcacgttcttcttc
tactgtgtcgttcttcccttgaccattttggtgcccgaagtcgaagtcccaaagtgggga
gcaatttacattccatgcatcatcaccactctcaactctgttggcacacccaggtcgatt
catttgttattttactggattctgttcgagaatgtgatgtccttccaccgaaccaaggcc
accttcatcgggctgcttgaattcagaagagccaacgagtgggttgtcaccgaaaaactg
ggagatgctctcaagaacaaatcaaccgccaaacccgtagccaggaagacaaagtcattc
ttcggagacaggatcctgccacaagagttggggttcgccgtcttcctcttcttctgcggc
tgctacgatttcctgtacgggaagaaccagtacttcatatacctcttcctgcaagtcata
accttcaccattgccggatttggctacatcggcaccatagtcccatcctag

DBGET integrated database retrieval system